Recombinant Laribacter hongkongensis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

The recombinant MscL is synthesized using a codon-optimized gene cloned into E. coli. Key steps include:

  1. Induction: IPTG-driven expression under T7 promoter control.

  2. Membrane Extraction: Detergent solubilization of the channel from E. coli membranes.

  3. Affinity Chromatography: Ni-NTA resin for His tag–mediated purification .

Mechanosensitive Gating

  • Mechanism: Membrane tension triggers an iris-like expansion of the MscL pore, increasing its diameter to ~3 nm. This conformational change is driven by tilting of transmembrane helices (M1 and M2) by 35° .

  • Role in Osmoprotection: Acts as an emergency valve during osmotic downshock, preventing cell lysis by releasing cytoplasmic solutes .

Electrophysiological Properties

ParameterValue
Conductance~3 nS
Activation Threshold~10–12 mN/m membrane tension
PermeabilityNon-selective (ions, water, small proteins ≤9 kDa)

Drug Delivery Systems

  • Recombinant MscL has been reconstituted into lipid vesicles for controlled release of molecules (e.g., antibiotics, peptides) in response to osmotic or chemical triggers .

  • Demonstrated utility in delivering phalloidin (a cell-impermeable toxin) into mammalian cells via charge-induced activation .

Evolutionary and Ecological Significance

  • Conservation: MscL homologs exist in bacteria, archaea, and plants but are absent in animals .

  • Adaptive Role: Critical for Laribacter hongkongensis survival in fluctuating aquatic environments and host intestines .

Challenges and Future Directions

  • Heterologous Expression: Optimization of folding and stability in non-native hosts .

  • Biotechnological Potential: Engineering MscL variants for targeted drug delivery or biosensing applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; LHK_02562; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Laribacter hongkongensis (strain HLHK9)
Target Names
mscL
Target Protein Sequence
MFKEFREFAMRGNVIDLAVGVVIGAAFGSIVKSLVDDIIMPPIGLLIGKVNFADLFITLK AGATPGPYATVAAAKAAGAVTMNVGQFINSVVSFVLIAFSVFLLVKVVNRLYQKKDAAAP APATRDCPFCATAIPLAATRCPHCTSQVPPAD
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Laribacter hongkongensis and why study its mechanosensitive channels?

Laribacter hongkongensis is a facultatively anaerobic, non-sporulating, gram-negative, seagull or spiral rod-shaped bacterium that belongs to the Neisseriaceae family of the β-subclass of Proteobacteria 3. It has been isolated from human cases of diarrhea and is considered a potential enteric pathogen, with epidemiological associations to fish consumption and freshwater environments 3. Studying mechanosensitive channels in this organism is valuable because these proteins play crucial roles in bacterial osmoregulation and survival in changing environments, particularly relevant for L. hongkongensis as it transitions between aquatic habitats and the human gastrointestinal tract.

How does L. hongkongensis MscL compare to well-characterized MscL proteins from other bacteria?

While specific data on L. hongkongensis MscL is limited, mechanosensitive channels are highly conserved across bacterial species in terms of their core structure and function. Based on what we know about L. hongkongensis as a member of the β-proteobacteria, its MscL likely shares structural similarities with characterized homologs while potentially exhibiting unique adaptations that reflect the organism's ecological niche spanning freshwater environments and human hosts . Phylogenetic analysis would be recommended to determine its relationship to other bacterial MscL proteins, particularly since L. hongkongensis possesses other unique proteins, such as its AmpC beta-lactamase that shares <50% amino acid sequence identity with other known examples .

What genomic resources are available for studying L. hongkongensis MscL?

Researchers can utilize complete genome sequences of reference strains such as HLHK9, which has been fully sequenced . Additionally, draft genomes of strains like PW3643 are available . When analyzing the genetic context of the mscL gene, researchers should examine upstream and downstream regions for regulatory elements that might control expression, similar to approaches used for studying other genes like ampC in this organism. Sequence analysis should incorporate comparative genomics to identify conserved domains characteristic of mechanosensitive channels.

What expression systems are most suitable for recombinant L. hongkongensis MscL production?

For recombinant production of L. hongkongensis MscL, E. coli expression systems (particularly BL21(DE3) or C43(DE3) for membrane proteins) typically provide good yields. Consider using vectors with fusion tags (such as His6, MBP, or SUMO) that facilitate purification while maintaining protein functionality. Because membrane proteins like MscL can be challenging to express, expression conditions should be optimized through systematic testing of induction temperatures (16-30°C), inducer concentrations (0.1-1.0 mM IPTG), and growth media formulations. Based on methods used for other L. hongkongensis proteins, expression yields should be monitored through Western blotting using tag-specific antibodies .

What purification strategy should be employed for recombinant L. hongkongensis MscL?

A recommended purification protocol would include:

  • Membrane isolation through differential centrifugation following cell disruption

  • Solubilization using detergents (initially test DDM, LDAO, and C12E8)

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography for final purification

Detergent selection is critical for maintaining channel functionality. A comparative analysis similar to approaches used for studying AmpC in L. hongkongensis would be beneficial, where multiple conditions are systematically tested and evaluated for protein stability and activity . Protein purity should be verified through SDS-PAGE and mass spectrometry to ensure integrity of the recombinant protein.

How can the function of purified L. hongkongensis MscL be assessed?

Functional characterization can be performed using:

  • Liposome reconstitution assays - measuring fluorescent dye efflux upon osmotic downshift

  • Patch-clamp electrophysiology - directly measuring channel conductance

  • In vivo complementation assays - using MscL-deficient E. coli strains challenged with osmotic shock

Functional AssayParameters to MeasureExpected Outcomes for Active MscL
Liposome AssayFluorescence intensity over timeRapid dye release upon hypoosmotic shock
Patch-clampSingle-channel conductance~3 nS in standard conditions
Osmotic Shock SurvivalColony forming unitsRestored survival in complemented strains

Verification of function is essential before proceeding to more complex studies, as membrane protein reconstitution can be challenging and requires optimization of lipid composition and protein:lipid ratios.

How do environmental conditions affect L. hongkongensis MscL function?

Given that L. hongkongensis inhabits both aquatic environments and the human gastrointestinal tract, its MscL likely functions across varying pH, temperature, and ionic conditions 3. Design experiments that systematically test channel activity across pH ranges (5.0-8.0), temperatures (25-37°C), and various ions (Na+, K+, Ca2+, Mg2+) at physiologically relevant concentrations. Patch-clamp electrophysiology or fluorescence-based assays can be used to measure channel gating properties under these different conditions. Consider correlating these functional studies with L. hongkongensis growth conditions, as the bacterium shows variable phenotypes in different environments, similar to the variation observed in antimicrobial resistance profiles .

What structural dynamics characterize L. hongkongensis MscL during gating?

Address this question using a combination of:

  • Site-directed mutagenesis of conserved residues predicted to be involved in channel gating

  • FRET-based approaches using strategically placed fluorophores to monitor conformational changes

  • Molecular dynamics simulations based on homology models

Focus particularly on the transmembrane domains and the pore-lining residues, which likely undergo substantial conformational changes during channel opening. Analysis should incorporate comparisons to the gating mechanisms of well-characterized MscL proteins from other bacteria, while accounting for unique sequences or structural elements in the L. hongkongensis channel.

How does L. hongkongensis MscL interact with other components of the cell envelope?

Investigate potential protein-protein and protein-lipid interactions through:

  • Co-immunoprecipitation with native membrane extracts

  • Bacterial two-hybrid screening

  • Lipid binding assays using various membrane lipid compositions

Particular attention should be paid to interactions with peptidoglycan synthesis machinery and other osmoregulatory systems, which might coordinate responses to environmental changes. This approach would be similar to investigations of how the AmpC beta-lactamase in L. hongkongensis interacts with other antimicrobial resistance determinants .

What strategies can overcome low expression yields of recombinant L. hongkongensis MscL?

If expression yields are problematic:

  • Test codon optimization for the expression host

  • Evaluate alternative fusion partners (SUMO, MBP, Trx)

  • Screen additional expression hosts (C41/C43, Lemo21)

  • Consider cell-free expression systems for toxic or difficult membrane proteins

Additionally, examine growth conditions carefully, as L. hongkongensis has specific growth requirements that might influence recombinant protein expression. The organism shows variability in gene expression patterns under different conditions, as demonstrated by the differential expression of ampC observed across isolates .

How can aggregation and misfolding of recombinant L. hongkongensis MscL be addressed?

Protein aggregation can be mitigated through:

  • Lowering expression temperature (16-20°C)

  • Testing a broader panel of detergents (MNG, GDN, SMA copolymers)

  • Including stabilizing additives during purification (glycerol, specific lipids)

  • Optimizing buffer compositions (pH, salt concentration, reducing agents)

Consider also the native membrane environment of L. hongkongensis, which as a facultative anaerobe may require specific lipid compositions or redox conditions for optimal protein folding .

How can researchers resolve contradictory functional data for L. hongkongensis MscL?

When functional assays yield inconsistent results:

  • Verify protein integrity through mass spectrometry and circular dichroism

  • Examine detergent effects by comparing multiple detergent types

  • Control for lipid composition in reconstitution experiments

  • Ensure membrane tension is appropriately calibrated in electrophysiology studies

Systematic documentation of experimental conditions is crucial for troubleshooting, similar to the careful characterization required when distinguishing between true ESBL and AmpC-mediated phenotypes in L. hongkongensis antibiotic resistance studies .

How might L. hongkongensis MscL contribute to bacterial pathogenesis and survival in hosts?

Investigate the role of MscL in pathogenesis through:

  • Creation of mscL deletion mutants and assessment of their virulence in appropriate models

  • Analysis of mscL expression during infection or under host-mimicking conditions

  • Evaluation of MscL as a potential drug target

This approach would parallel methods used to study the contribution of other genes to L. hongkongensis physiology, such as the deletion of ampC to determine its role in antimicrobial resistance phenotypes . Consider also how MscL might contribute to survival in the varied environments L. hongkongensis encounters, from freshwater to the human intestinal tract 3.

What is the potential for developing MscL-targeted antimicrobials specific to L. hongkongensis?

To explore MscL as a therapeutic target:

  • Perform high-throughput screening for compounds that specifically modulate L. hongkongensis MscL

  • Develop structure-based drug design approaches if structural data becomes available

  • Assess specificity by comparing effects on human mechanosensitive channels

Given that L. hongkongensis is associated with gastroenteritis and is found in various countries across multiple continents, including Asia, Europe, Africa, and Central America, novel antimicrobial approaches could have global significance3.

How does L. hongkongensis MscL activity correlate with environmental adaptation?

Design studies that examine:

  • MscL expression patterns across environmental isolates versus clinical isolates

  • Functional variations of MscL between strains from different sources (human vs. fish)

  • Expression regulation under various stress conditions

This research direction would build on observations that L. hongkongensis shows phenotypic differences between isolates from different sources, as seen in the varying prevalence of ESBL-positive phenotype between human isolates (95.2%) and fish isolates (57.1%) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.