Recombinant Laribacter hongkongensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Role in Antibiotic Resistance

L. hongkongensis YidC indirectly contributes to antibiotic resistance by supporting membrane insertion of resistance factors:

  • AmpC β-lactamase: A chromosomally encoded enzyme conferring resistance to cephalosporins and penicillins .

    • Deletion of ampC reduces MICs for ceftazidime (128 → 32 mg/L) and ceftriaxone (128 → 16 mg/L) .

    • ESBL-positive phenotype in L. hongkongensis is linked to AmpC overexpression .

AntibioticMIC (Wild Type)MIC (ΔampC)Fold Change
Ampicillin64 mg/L1 mg/L64x↓
Ceftazidime128 mg/L32 mg/L4x↓
Amoxicillin/clavulanate2 mg/L0.0625 mg/L32x↓

Applications in Research

Recombinant YidC is used to:

  • Study membrane protein insertion mechanisms in proteoliposomes .

  • Investigate bacterial respiratory complexes (e.g., cytochrome bo oxidase, F1Fo ATPase) .

  • Develop inhibitors targeting YidC-Sec interactions for antimicrobial therapies .

Expression and Purification Protocol

  • Cloning: Full-length yidC (C1D6H8) cloned into E. coli vectors .

  • Purification: Immobilized metal affinity chromatography (IMAC) via His tag .

  • Storage: Lyophilized at -20°C/-80°C; reconstitute in sterile water with 50% glycerol .

Evolutionary Conservation

YidC homologs exist in:

  • Mitochondria: Oxa1 (yeast) .

  • Chloroplasts: Alb3 .

  • ER: Get1/2 .

These homologs share a conserved 5-TM core, underscoring YidC’s universal role in membrane protein biogenesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yidC; LHK_03236; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-550
Protein Length
full length protein
Species
Laribacter hongkongensis (strain HLHK9)
Target Names
yidC
Target Protein Sequence
MDTKRLIVFIVLSFGLLFVWQEYFAPKPQPKPVAAAVQPDGTPAPATARPADSPATGKLT SAQTITVTTDLVKAQINTAGGDIRSLELLTQGAIDNPDKPFMLMTEQGGRTYVAQSGLLS SDASLPTHKTLYAADKTAYTLLPDQNTLTVTLAAAPVNGVEVKKIFTFKRDSYVIDVRYD IINHSDKPVDATAYYRLLRDGKAPEGESSMAHTFTGPAVYTETGKFQKVSFEDLAKGKGD YVRQADNGWVAMVQHYFVSAWILKTNDGKSVCSSAEACQFELKPAAGDLYSAGVLVKLPV VAAGQQYSIDMPLYAGPEDTRRMATVAPGLVLTKDYGWVTIIATPLFWLLDKLYGLVHNW GWAIVLLTVLVKAAFYPLSAASYRSMAKMKALAPRMQRLKEQYGDDRQKFQQATMEMYKT EKVNPLGGCLPIVVQIPVFIGLYWALLASVELRQAPWILWIHDLAKPDPYYILPALMAAT MYLQTFLNPPPADPLQAKMMKIMPLAFSVMFFFFPAGLVLYWLVNNILSIAQQWWVNKQI EKDAAKAKSS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Laribacter hongkongensis Membrane protein insertase YidC?

Laribacter hongkongensis Membrane protein insertase YidC is a critical protein involved in the biogenesis of bacterial inner membrane proteins. It belongs to the Oxa1 superfamily and plays an essential role in facilitating the insertion and proper folding of various membrane proteins . The full-length protein (amino acids 1-550) contains multiple transmembrane segments that anchor it within the bacterial membrane, enabling its insertase function . L. hongkongensis, the source organism, is a recently discovered bacterium associated with community-acquired gastroenteritis and exhibits resistance to most beta-lactams except carbapenems .

What is the structural organization of YidC protein?

YidC protein exhibits a complex structural organization with five conserved transmembrane helices (excluding the non-conserved first transmembrane helix TM1 and P1 domain in E. coli YidC) . The protein threads back-and-forth through the membrane five times, with portions extending into the cytoplasmic region of the bacterial cell .

Structural analysis based on evolutionary co-variation, lipid-versus-protein exposure predictions, and molecular dynamics simulations reveals specific helix-helix interactions that stabilize the protein's core architecture . The five transmembrane helices form a rigid protein core, while the polar loop regions interact with the membrane surface . Importantly, the YidC core is stabilized by both short and long-range interactions between the five helices, with residues toward the cytoplasmic side being primarily polar or charged (engaged in electrostatic interactions) and periplasmic residues being predominantly aromatic (involved in stacking and nonpolar dispersion interactions) .

What expression systems are recommended for recombinant production of L. hongkongensis YidC?

For recombinant production of L. hongkongensis YidC, E. coli expression systems have proven effective as demonstrated in available research . When expressing membrane proteins like YidC, consider the following methodological approach:

  • Clone the full-length YidC gene (amino acids 1-550) into an appropriate expression vector with an N-terminal His-tag for purification .

  • Transform the construct into an E. coli strain optimized for membrane protein expression.

  • Culture the bacteria under controlled conditions to minimize protein aggregation.

  • For purification, solubilize membrane fractions with a mild detergent like n-dodecyl β-D-maltoside (DDM) .

  • Affinity purify using Ni-NTA agarose beads, followed by size exclusion chromatography if higher purity is required .

The recombinant protein should be stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For long-term storage, the addition of 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended to prevent repeated freeze-thaw cycles .

How can researchers verify the functional activity of recombinant YidC?

Verifying the functional activity of recombinant YidC requires multiple complementary approaches:

  • In vivo complementation assays: Create YidC-depleted bacterial strains and test whether the recombinant protein can restore normal growth and membrane protein insertion . This approach can also be used to test YidC mutants.

  • Co-expression studies: Express known YidC substrates (like M13 procoat, Pf3 coat proteins, or F1-F0 subunit F0c) together with recombinant YidC and measure the substrate production levels by western blotting . Functional YidC should enhance the biogenesis of these substrates.

  • Interaction verification: Perform proximity-dependent biotin labeling (BioID) or affinity purification-mass spectrometry to identify proteins that interact with YidC, such as YibN .

  • Membrane insertion assays: Develop in vitro systems using purified YidC reconstituted into liposomes to directly test its ability to insert model substrate proteins into membranes.

The table below summarizes key YidC substrate proteins that can be used to verify functional activity:

Substrate ProteinDescriptionDetection MethodExpected Outcome with Active YidC
M13 procoat (PC)-LepPhage coat protein fused to leader peptidaseWestern BlotEnhanced biogenesis
Pf3-23LepPhage coat protein fused to leader peptidaseWestern BlotEnhanced biogenesis
F0cATP synthase subunitWestern BlotEnhanced biogenesis
SecGSmall membrane proteinWestern BlotEnhanced biogenesis

What is the molecular mechanism of YidC-mediated membrane protein insertion?

The molecular mechanism of YidC-mediated membrane protein insertion involves several coordinated steps:

  • Ribosome binding: YidC directly interacts with the ribosome at the site where the newly formed protein chain exits . This interaction positions YidC to receive nascent membrane proteins as they emerge from the ribosome.

  • Hydrophobic interaction: The transmembrane segments of YidC form a hydrophobic environment that facilitates the proper orientation and folding of the substrate protein's transmembrane domains.

  • Insertion pathway: YidC likely provides a protected environment for substrate proteins to transition from the aqueous environment of the cytoplasm into the hydrophobic membrane bilayer.

  • Lipid interaction and organization: Beyond its role as an insertase, YidC functions as a lipid scramblase, contributing to the organization of the lipid bilayer during membrane protein insertion .

Molecular dynamics simulations have revealed that the stability of YidC in the membrane is maintained by hydrophobic residues on the exterior of the transmembrane bundle that interact with apolar lipid tails, while the core is stabilized by interactions between the five helices .

How does YibN enhance YidC function in membrane protein biogenesis?

YibN has been identified as a critical interactor of YidC with significant implications for membrane protein biogenesis . Research utilizing proximity-dependent biotin labeling (BioID) and affinity purification-mass spectrometry has demonstrated that:

  • YibN physically associates with YidC in native membranes, as confirmed by on-gel binding assays with purified proteins .

  • Co-expression studies reveal that YibN enhances the production and membrane insertion of established YidC substrates, including:

    • M13 and Pf3 phage coat proteins

    • ATP synthase subunit c (F0c)

    • Small membrane proteins like SecG

  • The enhancement effect appears to be influenced by the hydrophobicity of transmembrane segments. For example, YibN shows differential effects on wild-type SecG compared to the I20E mutant with altered first transmembrane segment hydrophobicity .

  • YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC's lipid scramblase activity .

This interaction represents an important regulatory mechanism for YidC function, potentially allowing cells to modulate membrane protein insertion efficiency under different conditions.

What critical residues determine YidC functionality, and how can they be experimentally verified?

Several critical residues have been identified that are essential for YidC functionality:

  • Stabilizing core residues: Molecular dynamics simulations and in vivo complementation assays have identified residues crucial for YidC stability and function:

    • T362 in TM2 and Y517 in TM6 are particularly critical, as alanine mutations at these positions completely inactivate YidC despite stable expression of the mutant proteins

    • F433, M471, and F505 show intermediate activity levels when mutated

  • Membrane-interaction residues: Hydrophobic residues on the exterior of the transmembrane bundle stabilize interactions with the apolar lipid tails .

  • Core stabilizing residues: The YidC core is stabilized by both polar/charged residues toward the cytoplasmic side (involved in electrostatic interactions) and aromatic residues on the periplasmic side (involved in stacking and nonpolar interactions) .

These critical residues can be experimentally verified through:

  • Site-directed mutagenesis: Create alanine mutants or other substitutions at positions of interest.

  • In vivo complementation assays: Test whether mutants can complement YidC depletion in bacterial strains.

  • Stability assessment: Perform western blotting to confirm that loss of function is not due to protein instability or degradation.

  • Structural analysis: Use techniques like cryo-electron microscopy to observe structural changes in mutant proteins.

How does YidC research contribute to understanding bacterial pathogenesis?

Research on L. hongkongensis YidC has significant implications for understanding bacterial pathogenesis:

  • L. hongkongensis is a recently discovered bacterium associated with community-acquired gastroenteritis and shows resistance to most beta-lactams except carbapenems .

  • YidC is essential for the biogenesis of many membrane proteins that play critical roles in bacterial physiology, including proteins involved in energy metabolism, cell envelope maintenance, and virulence factor secretion.

  • Understanding the mechanism of YidC-mediated membrane protein insertion could reveal potential targets for novel antibacterial therapies that disrupt this essential process.

  • The interaction between YidC and YibN represents a potential regulatory mechanism that could be exploited to modulate bacterial membrane composition and function .

  • Since YidC is conserved across bacterial species but distinct from eukaryotic homologs, it presents an attractive target for selective antibacterial intervention.

What emerging technologies are advancing the study of membrane protein insertases like YidC?

Several cutting-edge technologies are advancing our understanding of membrane protein insertases:

  • Evolutionary co-variation analysis: This computational approach has proven valuable for predicting structural models of YidC based on evolutionary coupling between residue pairs .

  • Cryo-electron microscopy: This technique allows visualization of YidC-ribosome complexes, revealing how YidC interacts with the ribosome during co-translational membrane protein insertion .

  • Molecular dynamics simulations: MD simulations provide insights into the stability and functional mechanisms of YidC in the bacterial membrane environment .

  • Proximity labeling methods: Techniques like BioID enable identification of proteins within the YidC neighborhood in living cells, revealing interaction partners like YibN .

  • SILAC proteomics: Stable isotope labeling with amino acids in cell culture combined with mass spectrometry allows for quantitative analysis of protein interactions under near-native conditions .

  • In vitro reconstitution systems: Purified components reconstituted into liposomes or nanodiscs enable mechanistic studies of YidC-mediated insertion under defined conditions.

What are common challenges in working with recombinant membrane proteins like YidC?

Working with recombinant membrane proteins presents several challenges:

  • Expression and solubility: Membrane proteins often express poorly and tend to aggregate. For YidC, expression in E. coli systems has been successful, but optimization of expression conditions may be necessary .

  • Purification: Carefully select detergents that maintain protein stability and function. For YidC studies, n-dodecyl β-D-maltoside (DDM) has been used successfully .

  • Storage stability: Multiple freeze-thaw cycles should be avoided. Store working aliquots at 4°C for up to one week, and for long-term storage, add 5-50% glycerol and store at -20°C/-80°C .

  • Functional verification: Confirming function is challenging for membrane proteins. Use multiple approaches including in vivo complementation assays and substrate insertion assays .

  • Structural characterization: Traditional structural biology methods like X-ray crystallography are challenging for membrane proteins. Consider alternative approaches like evolutionary co-variation analysis and cryo-electron microscopy .

How can researchers optimize conditions for studying YidC-substrate interactions?

To optimize conditions for studying YidC-substrate interactions:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.