Recombinant Laribacter hongkongensis NADH-quinone oxidoreductase subunit K (nuoK) is a recombinant protein derived from the Laribacter hongkongensis strain, a Gram-negative bacterium linked to freshwater-associated gastroenteritis . This protein is a critical subunit of the NADH-quinone oxidoreductase complex (Complex I), which plays a central role in bacterial respiration .
The nuoK subunit is part of the NADH-quinone oxidoreductase complex, which couples NADH oxidation to quinone reduction, generating proton (or sodium) gradients across bacterial membranes . While Laribacter’s nuoK is structurally conserved, its specific ion-translocation mechanism (H⁺ vs. Na⁺) remains unclear, though bacterial Complex I typically pumps protons .
The recombinant nuoK protein is synthesized in E. coli and purified via affinity chromatography (His-tag) . Key suppliers include:
| Supplier | Catalog Number | Purity | Applications |
|---|---|---|---|
| Creative Biomart | RFL12683LF | High | Research, structural studies |
| CUSABIO | N/A | N/A | ELISA, antibody production |
KEGG: lhk:LHK_00537
STRING: 557598.LHK_00537
Laribacter hongkongensis is a Gram-negative bacillus belonging to the Neisseriaceae family of β subclass Proteobacteria. It has gained significance as an emerging pathogen associated with community-acquired gastroenteritis and travelers' diarrhea. The bacterium was first isolated in Hong Kong in 2001 from the blood and empyema of a patient with alcoholic cirrhosis, and subsequent reports have emerged from regions including Korea and China . The organism's ability to adapt to diverse environments and its multiple antibiotic resistance mechanisms have elevated its status as a potential public health concern. The complete genome of L. hongkongensis strain HLHK9 consists of a 3,169-kb chromosome with G+C content of 62.35%, containing genes that facilitate its survival in both human hosts (37°C) and freshwater environments (20°C) .
The NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I in the electron transport chain of L. hongkongensis. The full-length protein consists of 101 amino acids with the sequence: MLTLTHYLVLAAVMFAISVLGIFLNRKNVIVLLMAIELMLLAVNFNFIAFAHYFGDTAGQIFVFFVLTVAAAESAIGLAILVVLFRNLATINVEDLGQLKG . As part of the NADH dehydrogenase I complex (EC 1.6.99.5), nuoK participates in electron transfer from NADH to quinones, contributing to energy production through oxidative phosphorylation. The protein is highly hydrophobic and functions as a membrane-embedded subunit, facilitating proton translocation across the bacterial membrane during electron transport .
L. hongkongensis demonstrates remarkable temperature-dependent gene expression, allowing it to adapt to both human body temperature (37°C) and freshwater environments (20°C). Proteomic studies of L. hongkongensis HLHK9 cultured at these different temperatures reveal distinct expression patterns. A notable example is the differential expression of two homologous copies of the argB gene (argB-20 and argB-37), which encode isoenzymes of N-acetyl-L-glutamate kinase (NAGK-20 and NAGK-37) in the arginine biosynthesis pathway. NAGK-20 shows higher expression at 20°C and has a lower optimal temperature for enzymatic activity, while NAGK-37 is preferentially expressed at 37°C. Additionally, NAGK-20 is inhibited by arginine, suggesting a negative feedback control mechanism optimized for lower temperature environments .
The temperature adaptation mechanisms in L. hongkongensis share similarities with those observed in bacteria that inhabit extreme temperature environments. The presence of temperature-specific isoenzymes, such as the NAGK variants (NAGK-20 and NAGK-37), represents a sophisticated adaptation strategy. Similar duplicated copies of the argB gene have been identified in thermophilic bacteria from hot springs, including Thermus thermophilus, Deinococcus geothermalis, Deinococcus radiodurans, and Roseiflexus castenholzii .
The differential expression of these isoenzymes based on environmental temperature allows for optimal enzymatic activity across the bacterium's ecological niches. At the molecular level, these adaptations likely involve structural modifications that affect protein stability, substrate binding affinity, and catalytic efficiency at different temperatures. Research comparing the amino acid compositions, secondary structures, and thermodynamic properties of these temperature-specific proteins would provide valuable insights into the evolutionary strategies employed by bacteria to adapt to diverse thermal environments .
The nuoK subunit (NADH-quinone oxidoreductase subunit K) functions as an integral component of Complex I in the respiratory chain of L. hongkongensis. Based on structural homology with better-characterized bacterial systems, nuoK likely interacts with adjacent membrane subunits including nuoH, nuoJ, and nuoL to form the membrane domain of Complex I. The highly hydrophobic nature of nuoK, with its predominantly transmembrane helical structure, facilitates its integration into the lipid bilayer .
The interaction network within Complex I can be conceptualized as follows:
| Domain | Subunits | Primary Function | Interaction with nuoK |
|---|---|---|---|
| NADH dehydrogenase module | nuoE, nuoF, nuoG | NADH binding and oxidation | Indirect via intermediate subunits |
| Hydrogenase module | nuoB, nuoC, nuoD, nuoI | Electron transfer | Minimal direct interaction |
| Membrane domain | nuoH, nuoJ, nuoK, nuoL, nuoM, nuoN | Proton translocation | Direct physical contact, particularly with nuoH and nuoJ |
The nuoK subunit contains conserved charged residues within its transmembrane helices that are crucial for proton translocation. Mutations in these residues would likely disrupt the proton pumping activity of the entire complex, affecting energy production and bacterial growth under aerobic conditions .
While direct evidence linking nuoK to antibiotic resistance in L. hongkongensis is limited, the respiratory chain components, including NADH-quinone oxidoreductase, play indirect roles in antimicrobial resistance and virulence. The energy generated by the respiratory chain supports numerous cellular processes, including active efflux of antibiotics. L. hongkongensis possesses an extensive variety of transporters, including multidrug efflux pumps, which contribute to its resistance profile .
The bacterium demonstrates resistance to most beta-lactam antibiotics through a chromosomally encoded class C beta-lactamase (ampC), regulated by ampR. Both genes have been identified in all clinical isolates studied, with the ampR gene acting as a repressor for ampC expression . The energy required for the expression and function of these resistance mechanisms is partially dependent on the proper functioning of the respiratory chain, including the nuoK subunit.
Furthermore, respiratory chain function impacts the expression of virulence factors in many bacterial pathogens. L. hongkongensis possesses numerous virulence factors, including urease, bile salts efflux pump, adhesin, catalase, superoxide dismutase, hemolysins, RTX toxins, patatin-like proteins, phospholipase A1, and collagenases . Disruption of energy production through respiratory chain inhibition could potentially attenuate the expression of these virulence determinants.
The expression and purification of recombinant L. hongkongensis nuoK protein presents challenges due to its highly hydrophobic nature and membrane-embedded characteristics. Based on available information, the following methodological approach is recommended:
Expression Systems:
Baculovirus expression system: Demonstrated success for L. hongkongensis nuoK expression
E. coli expression system: Successfully used with N-terminal His-tag fusion
Optimal Expression Conditions:
Temperature: 20-25°C to prevent inclusion body formation
Induction: Mild induction with reduced IPTG concentration (0.1-0.5 mM) if using E. coli
Duration: Extended expression period (24-48 hours) at lower temperatures
Purification Protocol:
Cell lysis using detergent-based methods (e.g., n-dodecyl β-D-maltoside or CHAPS)
Initial purification using immobilized metal affinity chromatography (IMAC) with His-tag
Size exclusion chromatography for further purification
Concentrate to 0.1-1.0 mg/mL in appropriate buffer
Add 5-50% glycerol to final preparation for long-term storage
Storage Recommendations:
Store at -20°C/-80°C for lyophilized form (shelf life approximately 12 months)
Store at -20°C/-80°C for liquid form (shelf life approximately 6 months)
Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week
Functional characterization of nuoK requires assays that can measure its contribution to NADH-quinone oxidoreductase (Complex I) activity. Since nuoK functions as part of a multi-subunit complex, isolated protein assays have limitations. The following methodological approaches are recommended:
Whole Complex Activity Assays:
NADH:ubiquinone oxidoreductase activity: Measure the rate of NADH oxidation coupled to ubiquinone reduction spectrophotometrically at 340 nm.
Proton pumping assays: Utilize pH-sensitive fluorescent dyes (e.g., ACMA or pyranine) to monitor proton translocation in reconstituted proteoliposomes containing the complex.
Site-Directed Mutagenesis Approach:
Identify conserved amino acid residues in nuoK likely involved in proton translocation.
Generate point mutations in the nuoK gene.
Express the mutant complex in a heterologous system.
Measure changes in proton pumping efficiency and NADH oxidation activity.
Membrane Potential Analysis:
Use membrane potential-sensitive fluorescent dyes (e.g., DiSC3(5)) to monitor the contribution of nuoK to membrane potential generation.
Compare wild-type with nuoK-deficient or mutant strains.
Computational Analysis:
Molecular dynamics simulations to predict proton pathways through the nuoK subunit.
Homology modeling based on related bacterial Complex I structures to predict critical residues for functional analysis.
These approaches provide complementary data on the functional role of nuoK in the context of the complete NADH-quinone oxidoreductase complex.
The study of temperature-dependent differential expression of nuoK in L. hongkongensis requires a multi-faceted approach combining transcriptomic, proteomic, and functional analyses:
Transcriptomic Analysis:
RT-qPCR: Design specific primers for nuoK to quantify mRNA levels at different temperatures (20°C vs. 37°C).
RNA-Seq: Perform comprehensive transcriptome analysis to identify temperature-dependent expression patterns of nuoK relative to other genes.
Proteomic Analysis:
Western Blotting: Use specific antibodies against nuoK to quantify protein levels at different temperatures.
2D-DIGE (Two-Dimensional Differential Gel Electrophoresis): Compare protein expression profiles at 20°C vs. 37°C.
LC-MS/MS: Perform quantitative proteomics to measure precise changes in nuoK abundance.
Reporter Gene Assays:
Construct promoter-reporter fusions (e.g., nuoK promoter-GFP) to visualize temperature-dependent promoter activity.
Measure fluorescence intensity at different temperatures to quantify promoter strength.
Chromatin Immunoprecipitation (ChIP):
Identify transcription factors that bind to the nuoK promoter at different temperatures.
Perform ChIP-seq to map genome-wide binding patterns of relevant transcription factors.
Functional Validation:
Generate nuoK knockout mutants and complement with temperature-specific variants.
Assess growth characteristics and respiration rates at different temperatures.
This approach would parallel the methodology successfully employed to characterize the temperature-dependent expression of argB isoenzymes in L. hongkongensis, providing comprehensive insights into nuoK regulation .
Comparative genomic analysis of nuoK across diverse bacterial species offers a powerful approach to understand evolutionary adaptations in respiratory chain components. This research direction could explore:
Phylogenetic analysis: Construct phylogenetic trees based on nuoK sequences from various bacterial species, with special attention to those inhabiting different temperature ranges (psychrophiles, mesophiles, thermophiles).
Sequence conservation patterns: Identify highly conserved regions across all species versus variable regions that might confer specific environmental adaptations.
Gene duplication events: Investigate whether temperature-dependent gene duplication events, similar to those observed with argB in L. hongkongensis , have occurred with nuoK or other respiratory chain components.
Horizontal gene transfer (HGT) analysis: Determine if nuoK variants have been acquired through HGT events, potentially contributing to adaptive capabilities.
Selection pressure analysis: Calculate Ka/Ks ratios (non-synonymous to synonymous substitution rates) to identify regions of nuoK under positive or purifying selection.
Structural comparisons: Model the predicted structures of nuoK from different species to identify adaptations in protein folding, stability, and interaction surfaces.
This comparative approach would provide insights into how respiratory chain components have evolved to function optimally in diverse environmental niches, potentially informing biotechnological applications in bioenergy and biomedical fields.
The essential role of respiratory chain components in bacterial energy metabolism makes nuoK a promising drug target for novel antimicrobials against L. hongkongensis. Future research in this direction could explore:
Target validation: Generate conditional nuoK knockdown mutants to confirm essentiality under different growth conditions.
Structural studies: Determine the high-resolution structure of L. hongkongensis nuoK using cryo-electron microscopy or X-ray crystallography to identify potential drug-binding pockets.
Comparative analysis: Identify structural differences between bacterial nuoK and human respiratory chain components to develop selective inhibitors.
Virtual screening: Perform in silico screening of compound libraries against identified binding sites on nuoK.
Fragment-based drug discovery: Develop small molecule inhibitors targeting critical functional regions of nuoK.
Phenotypic screening: Test compound libraries for growth inhibition under conditions where respiratory chain function is essential.
Combination therapy approaches: Investigate synergistic effects between nuoK inhibitors and existing antibiotics, particularly beta-lactams to which L. hongkongensis shows resistance .
The development of respiratory chain inhibitors would represent a novel class of antimicrobials with potential activity against this emerging pathogen, which has demonstrated resistance to multiple antibiotics including beta-lactams.
Recombinant nuoK protein has potential applications in developing improved diagnostic tools for L. hongkongensis infections. Future research directions include:
Antibody development: Use purified recombinant nuoK to generate specific polyclonal or monoclonal antibodies for immunodiagnostic assays.
Immunoassay development:
ELISA-based detection of anti-nuoK antibodies in patient sera
Lateral flow immunoassays for rapid point-of-care testing
Immunofluorescence assays for direct detection in clinical samples
Molecular beacon probes: Design DNA probes targeting the nuoK gene for use in nucleic acid amplification tests.
Protein microarray applications: Include nuoK among a panel of L. hongkongensis antigens to develop comprehensive serological assays.
Aptamer development: Generate DNA or RNA aptamers against nuoK for use in aptamer-based biosensors.
Mass spectrometry-based approaches: Develop targeted proteomics assays to detect nuoK peptides directly from clinical samples.
These diagnostic approaches would address the current challenges in L. hongkongensis identification, which can be misidentified as other microbial flora using conventional techniques . Improved diagnostics would enable better epidemiological surveillance of this emerging pathogen across different geographical regions.
Membrane proteins like nuoK present significant technical challenges throughout the research process:
Expression challenges:
Toxicity to host cells when overexpressed
Protein misfolding and aggregation
Inclusion body formation requiring refolding protocols
Low expression yields compared to soluble proteins
Purification difficulties:
Requirement for detergents or membrane-mimetic systems
Protein instability when removed from membrane environment
Detergent interference with downstream applications
Challenges in removing lipid contaminants
Structural characterization limitations:
Difficulties in obtaining crystals for X-ray crystallography
Challenges in cryo-EM sample preparation
Spectroscopic technique limitations due to detergent interference
Conformational heterogeneity affecting structural studies
Functional assay complications:
Need for reconstitution into artificial membrane systems
Artifacts from non-native lipid environments
Difficulties in measuring vectorial activities (e.g., proton pumping)
Challenges in maintaining native quaternary structure interactions