Recombinant Laribacter hongkongensis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Laribacter hongkongensis Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Laribacter hongkongensis prolipoprotein diacylglyceryl transferase (Lgt) is a bioengineered enzyme derived from the Gram-negative bacterium L. hongkongensis. Lgt catalyzes the attachment of a diacylglyceryl group to the conserved cysteine residue in bacterial preprolipoproteins, a critical step in lipoprotein biosynthesis. This recombinant form is produced for research applications, enabling studies on bacterial membrane biogenesis, antibiotic resistance mechanisms, and pathogen-host interactions.

Production and Biochemical Characteristics

The recombinant Lgt from L. hongkongensis is synthesized in heterologous systems, including E. coli, yeast, or mammalian cells, with purity confirmed via SDS-PAGE (>85%) . Key technical specifications include:

ParameterDetails
Host OrganismsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE)
Storage ConditionsLiquid form: 6 months at -20°C/-80°C; lyophilized: 12 months at -20°C/-80°C
Uniprot IDC1DAB4
FunctionCatalyzes diacylglyceryl transfer to preprolipoproteins (EC=2.4.99.-)

Applications in Research

Recombinant L. hongkongensis Lgt serves as a tool for:

  1. Antibiotic Target Validation: Testing inhibitors of Lgt, a druggable target in Gram-negative bacteria .

  2. Membrane Biogenesis Studies: Investigating lipoprotein maturation pathways in L. hongkongensis and related pathogens.

  3. Host-Pathogen Interactions: Analyzing how lipoproteins contribute to virulence in L. hongkongensis, which causes gastroenteritis and bacteremia .

Comparative Analysis of Lgt Across Bacteria

The following table highlights structural and functional parallels between L. hongkongensis Lgt and homologs in other pathogens:

OrganismHost SystemKey FeaturesReference
L. hongkongensisE. coli/yeastPartial recombinant protein; used for biochemical assays
E. coliNativeEssential enzyme; seven transmembrane segments; Y26, N146, G154 critical
Mycobacterium tuberculosisNativeCatalyzes diacylglyceryl transfer; essential for pathogenesis

Challenges and Future Directions

Current limitations include:

  • Lack of Structural Data: No crystal structures or high-resolution imaging of L. hongkongensis Lgt.

  • Insufficient Functional Studies: Limited research on enzyme kinetics or inhibitor specificity.
    Future work could focus on:

  • Crystallography: Resolving Lgt’s 3D structure to guide drug design.

  • Antibiotic Development: Testing Lgt inhibitors against L. hongkongensis clinical isolates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and serves as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; LHK_02245; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Laribacter hongkongensis (strain HLHK9)
Target Names
lgt
Target Protein Sequence
MLTHPQFDPVAISLGPMAIRWYGLMYLVGFVLFIVLGNVRIRKGNTVFTPKMLDDLLFWG VLGVILGGRLGQVLFYEPGYYLDHPLEIFMVWKGGMSFHGGFLGVLAASWLFARRNHLSF WQVTDFVAPLVPLGLAAGRLGNFINGELWGRVTAPDKPWAMLFPQARGEDLQLAAGNPQY AQWFAQYGALPRHASQLYEVLLEGIVLFVVLWWFTSRPRARGQASAVFLIGYGIARFVCE YFRSPDEGIFGHSYLISMGQWLSLPMILAGAILWQWSRRHADNRFLR
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of prolipoprotein diacylglyceryl transferase (Lgt) in Laribacter hongkongensis?

Prolipoprotein diacylglyceryl transferase (Lgt) is an enzyme that catalyzes the initial step in the post-translational modification of bacterial lipoproteins. This process is critical for the biogenesis and functionality of lipoproteins, which are essential components of the bacterial cell envelope. Lgt specifically transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of a conserved cysteine residue in prolipoproteins. This modification facilitates subsequent cleavage by signal peptidases and acylation by other enzymes, ultimately yielding mature lipoproteins that are integrated into bacterial membranes.

In Laribacter hongkongensis, Lgt plays a pivotal role in maintaining cell envelope integrity and supporting virulence. Lipoproteins modified by Lgt are involved in various cellular processes, including nutrient acquisition, signal transduction, and interactions with host immune systems. Disruption of Lgt activity can lead to compromised membrane stability, increased susceptibility to environmental stressors, and attenuation of pathogenicity .

How does recombinant expression of L. hongkongensis Lgt facilitate its study?

Recombinant expression of L. hongkongensis Lgt enables researchers to produce the enzyme in heterologous systems such as Escherichia coli. This approach offers several advantages:

  • High Yield: Recombinant systems can produce large quantities of Lgt for biochemical and structural studies.

  • Controlled Environment: Expression in a well-characterized host allows precise manipulation of experimental conditions.

  • Functional Analysis: Recombinant Lgt can be purified and subjected to enzymatic assays to characterize its activity and substrate specificity.

  • Structural Insights: Recombinant production facilitates crystallization and structural determination using techniques like X-ray crystallography or cryo-electron microscopy.

To achieve successful recombinant expression, researchers must optimize factors such as codon usage, promoter strength, and host strain selection. Additionally, co-expression of molecular chaperones may be necessary to ensure proper folding of the enzyme .

What experimental methods are used to assess Lgt activity?

The activity of Lgt can be evaluated using biochemical assays that monitor the transfer of a diacylglyceryl moiety to prolipoprotein substrates. Common methods include:

  • Radioactive Labeling: Incorporation of radiolabeled diacylglyceryl groups into substrates can be detected using autoradiography or scintillation counting.

  • Mass Spectrometry: This technique identifies and quantifies modified lipoproteins based on their mass-to-charge ratios.

  • Chromatographic Techniques: High-performance liquid chromatography (HPLC) or thin-layer chromatography (TLC) can separate reaction products for analysis.

  • Coupled Enzyme Assays: These assays detect by-products such as glycerol phosphate released during the reaction.

For recombinant Lgt from L. hongkongensis, synthetic peptides mimicking prolipoprotein sequences are often used as substrates. The reaction conditions—including pH, temperature, and substrate concentration—must be carefully optimized to reflect physiological relevance .

What challenges arise when studying Lgt inhibitors?

Studying inhibitors of Lgt involves several challenges:

  • Specificity: Identifying compounds that selectively inhibit Lgt without affecting other enzymes in the lipoprotein biosynthesis pathway is crucial.

  • Resistance Mechanisms: Bacteria may develop resistance through mutations in Lgt or compensatory pathways.

  • Off-Target Effects: Potential inhibitors must be screened for unintended interactions with host proteins or other bacterial enzymes.

  • In Vivo Validation: Compounds effective in vitro may exhibit reduced efficacy in complex biological systems due to factors like bioavailability or metabolic degradation.

To address these challenges, researchers employ structure-based drug design, high-throughput screening, and genetic approaches such as CRISPR interference to validate target specificity .

How does Lgt contribute to antibiotic resistance mechanisms?

While Lgt itself is not directly involved in antibiotic resistance, its role in lipoprotein biosynthesis can influence bacterial susceptibility to certain antibiotics:

  • Membrane Integrity: Lipoproteins modified by Lgt contribute to the structural integrity of bacterial membranes, which serve as barriers against antimicrobial agents.

  • Efflux Pumps: Some lipoproteins function as components of efflux pumps that expel antibiotics from bacterial cells.

  • Immune Evasion: Lipoproteins play roles in modulating host immune responses, potentially enhancing bacterial survival during infection.

Inhibition of Lgt disrupts these processes, rendering bacteria more susceptible to antibiotics and immune clearance .

What are the implications of Lgt depletion on bacterial physiology?

Depletion or inhibition of Lgt leads to several physiological changes in bacteria:

  • Outer Membrane Defects: The absence of mature lipoproteins compromises membrane stability and increases permeability.

  • Growth Inhibition: Bacteria exhibit reduced growth rates due to impaired membrane-associated functions.

  • Increased Susceptibility: Depletion enhances sensitivity to environmental stressors, host immune factors, and antimicrobial agents.

These effects underscore the potential of targeting Lgt as a novel antibacterial strategy .

How do structural studies inform our understanding of Lgt function?

Structural studies provide insights into the catalytic mechanism and substrate specificity of Lgt:

  • Active Site Architecture: High-resolution structures reveal key residues involved in binding phosphatidylglycerol and prolipoprotein substrates.

  • Conformational Dynamics: Structural analyses highlight conformational changes associated with catalysis.

  • Inhibitor Binding: Structures of Lgt-inhibitor complexes guide the design of potent and selective inhibitors.

Techniques such as X-ray crystallography and cryo-electron microscopy have been instrumental in elucidating these aspects .

What experimental models are used to study L. hongkongensis Lgt?

Experimental models include:

  • In Vitro Systems: Recombinant protein assays provide direct measurements of enzymatic activity.

  • Bacterial Mutants: Gene knockout or knockdown strains help elucidate the physiological role of Lgt.

  • Animal Models: Infection studies in mice or other hosts assess the contribution of Lgt to virulence.

Each model offers unique advantages but also presents limitations that must be considered when interpreting results .

How does CRISPR interference facilitate functional studies of Lgt?

CRISPR interference (CRISPRi) uses catalytically inactive Cas9 (dCas9) proteins guided by RNA sequences to repress gene expression without altering genomic DNA:

  • Targeted Knockdown: CRISPRi enables precise downregulation of lgt expression.

  • Phenotypic Analysis: Reduced expression levels allow researchers to study partial loss-of-function effects.

  • Synthetic Sensitivity Testing: Combining CRISPRi with chemical inhibitors reveals synergistic interactions.

This approach has been successfully applied to study essential genes like lgt .

What future directions should research on L. hongkongensis Lgt take?

Future research should focus on:

  • Mechanistic Studies: Elucidating detailed catalytic mechanisms and substrate interactions.

  • Inhibitor Development: Designing selective inhibitors with improved pharmacokinetic properties.

  • Therapeutic Applications: Exploring the potential of targeting Lgt for treating infections caused by multidrug-resistant bacteria.

Advances in these areas will enhance our understanding of bacterial physiology and inform novel therapeutic strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.