Recombinant Laribacter hongkongensis Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Understanding Undecaprenyl-diphosphatase (uppP)

Undecaprenyl-diphosphatase (EC 3.6.1.27) is a bacterial enzyme critical for recycling undecaprenyl pyrophosphate (Und-P), a lipid carrier essential for the synthesis of peptidoglycan and other cell wall components . It catalyzes the hydrolysis of Und-P to undecaprenyl monophosphate, enabling the regeneration of this carrier molecule for repeated use in glycan biosynthesis. This enzyme is also implicated in bacitracin resistance, as bacitracin inhibits the dephosphorylation step .

Key Features of Recombinant uppP Proteins

Recombinant uppP proteins are typically expressed in E. coli or other heterologous systems, often with N-terminal His-tags for purification. Their biochemical properties include:

CharacteristicValue/Details
Protein LengthFull-length (e.g., 187–296 amino acids depending on species)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with trehalose (6%) or glycerol (50%)
FunctionDephosphorylates undecaprenyl pyrophosphate to undecaprenyl monophosphate

Role in Bacterial Physiology

In Laribacter hongkongensis, a β-proteobacterium associated with gastrointestinal infections, cell wall synthesis is vital for survival in hostile environments (e.g., acidic stomach pH, bile exposure) . While uppP is not explicitly documented in L. hongkongensis genomes, its role in other bacteria suggests:

  • Cell Wall Integrity: Maintenance of peptidoglycan synthesis during rapid growth or stress .

  • Antibiotic Resistance: Bacitracin resistance via Und-P recycling .

Comparative Analysis of uppP in Other Species

Data from recombinant uppP proteins in Azospirillum brasilense and Staphylococcus carnosus highlight conserved features:

SpeciesGene LocusUniProt IDKey Features
Azospirillum brasilenseuppPP39438Full-length (1–187 aa), His-tagged, expressed in E. coli
Staphylococcus carnosusSca_0330B9DK59Full-length (1–296 aa), Tris/glycerol storage buffer

Relevance to Laribacter hongkongensis

While no direct studies on L. hongkongensis uppP exist in the provided sources, genomic data reveal:

  • Cell Wall Adaptation: L. hongkongensis possesses urease and bile efflux systems for acid/bile resistance, suggesting robust cell wall maintenance mechanisms .

  • Antibiotic Resistance: The genome encodes β-lactamases (e.g., AmpC) and multidrug efflux pumps, indicating a complex stress response system .

Gaps and Future Directions

  1. Experimental Verification: Recombinant expression of L. hongkongensis uppP is needed to confirm its enzymatic activity and substrate specificity.

  2. Functional Link to Pathogenicity: Studies on how uppP contributes to biofilm formation or evasion of host immune responses in L. hongkongensis are warranted.

  3. Therapeutic Implications: Inhibitors targeting uppP could disrupt cell wall synthesis, offering novel antibiotic strategies against L. hongkongensis infections.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. Should you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; LHK_02940; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Laribacter hongkongensis (strain HLHK9)
Target Names
uppP
Target Protein Sequence
MDWLLLAKAAIMGIVEGLTEFFPISSTGHLIVVGDLINFDDRIGNVFEVVIQLGAILAVC WEYRARLWQVAIDLPTSTMARKFVLNLLIAFLPAAIVGVLLIKTIKSYLFNPVAVACALV VGGLVILWAERRECTARVHRIDDMSHLDALKVGLAQIASLIPGTSRSGSTIIGGMLFGLD RRVATEFSFFLAIPIMFAATAYDVLKHWELFTAADLPTFGTGFLFAFLSAFVAVRGLIRF VASHTFNVFAWYRIVFGLIILGSWWLGWINWAS
Uniprot No.

Target Background

Function

Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.

Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Laribacter hongkongensis and why is it of microbiological significance?

Laribacter hongkongensis is a facultatively anaerobic, gram-negative bacterium first isolated from the blood and empyema of a cirrhotic patient. The cells exhibit distinctive seagull-shaped or spiral rod morphology. This bacterium belongs to the Neisseriaceae family within the β-subclass of Proteobacteria, with a genomic size of approximately 3 Mb and a G+C content of 68.0% ± 2.43% .

L. hongkongensis has been associated with community-acquired gastroenteritis, making it a potentially emerging pathogen warranting further research attention. The bacterium can grow on sheep blood agar as nonhemolytic, gray colonies of approximately 1 mm diameter after 24 hours of incubation at 37°C. It demonstrates growth capability at temperatures ranging from 25°C to 42°C but not at 4°C, 44°C, or 50°C. Additionally, it can tolerate NaCl concentrations of 1-2% but not higher levels .

What is the role of Undecaprenyl-diphosphatase (uppP) in bacterial cell physiology?

Undecaprenyl-diphosphatase (uppP) plays a critical role in bacterial cell wall biosynthesis by catalyzing the dephosphorylation of undecaprenyl diphosphate to form undecaprenyl phosphate, a carrier lipid essential for peptidoglycan synthesis. The enzyme functions within the complex pathway that produces peptidoglycan, the major structural component of bacterial cell walls .

In the context of the bacterial cell wall synthesis pathway, uppP facilitates the recycling of the lipid carrier, allowing continued production of cell wall components. This process intersects with the pathway involving Undecaprenyl Diphosphate Synthase (UPPS), which is responsible for synthesizing undecaprenyl diphosphate, the substrate for uppP .

How does uppP contribute to antimicrobial resistance mechanisms?

UppP has been identified as an alternative name for "Bacitracin resistance protein," suggesting its direct involvement in antimicrobial resistance mechanisms . This connection is particularly significant because bacitracin is an antibiotic that targets cell wall synthesis by binding to undecaprenyl pyrophosphate, preventing its dephosphorylation and recycling.

The enzyme's role in recycling undecaprenyl carriers makes it critical for maintaining cell wall integrity under antibiotic stress. Inhibiting uppP would potentially disrupt peptidoglycan synthesis, making it a promising target for novel antimicrobial development. This is especially important given the increasing prevalence of antibiotic resistance to conventional drugs targeting cell wall synthesis, such as methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin-resistant Enterococci (VRE) .

What enzymatic classification and catalytic properties characterize uppP?

UppP is classified as an enzyme with the EC number 3.6.1.27, placing it in the hydrolase family acting on acid anhydrides. Specifically, it catalyzes the hydrolysis of undecaprenyl diphosphate to undecaprenyl phosphate and inorganic phosphate .

The catalytic mechanism likely involves conserved residues within the protein that coordinate the diphosphate group of the substrate and facilitate nucleophilic attack by a water molecule. The reaction can be represented as:

Undecaprenyl diphosphate+H2OUndecaprenyl phosphate+Pi\text{Undecaprenyl diphosphate} + \text{H}_2\text{O} \rightarrow \text{Undecaprenyl phosphate} + \text{P}_i

This dephosphorylation is critical for recycling the lipid carrier in peptidoglycan synthesis and is therefore essential for bacterial cell wall formation and integrity.

How is the gene encoding L. hongkongensis uppP organized and regulated?

The uppP gene in L. hongkongensis is identified by the locus name LHK_02940. Unlike some bacterial genes involved in cell wall synthesis, such as ampC (which encodes β-lactamase in L. hongkongensis), there is no specific information in the search results regarding the regulatory mechanisms governing uppP expression .

What are the optimal expression and purification methods for recombinant L. hongkongensis uppP?

Based on available information about recombinant L. hongkongensis uppP, the following expression and purification strategies are recommended:

Expression Systems:

  • Bacterial expression systems, particularly E. coli, are suitable for uppP expression

  • Expression plasmids with moderate copy numbers (20-30 copies per cell) may help reduce toxicity issues that can arise with membrane proteins

  • The use of inducible promoters can allow controlled expression

Purification Strategy:

  • Cell lysis using appropriate buffer systems containing detergents to solubilize membrane proteins

  • Initial purification using affinity chromatography (depending on the tag used during recombinant production)

  • Further purification using ion exchange chromatography or size exclusion chromatography

  • Storage in a Tris-based buffer containing 50% glycerol for stability

While specific optimization parameters for L. hongkongensis uppP are not detailed in the search results, researchers can draw from general membrane protein methodologies and the reported storage conditions (Tris-based buffer with 50% glycerol) .

What storage and handling conditions maintain optimal activity of recombinant uppP?

According to the product information available, recombinant L. hongkongensis uppP should be handled and stored as follows:

Storage Conditions:

  • Store at -20°C for routine use

  • For extended storage, preserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Working aliquots may be stored at 4°C for up to one week

Buffer Composition:

  • Tris-based buffer system

  • 50% glycerol for protein stabilization

  • Buffer pH and additional components should be optimized for this specific protein

These recommendations aim to preserve the native conformation and enzymatic activity of the protein by minimizing denaturation, aggregation, and proteolytic degradation.

What analytical methods can be used to assess the activity and inhibition of uppP?

Several analytical approaches can be employed to assess the enzymatic activity and inhibition of uppP:

Enzymatic Activity Assays:

  • Phosphate Release Assay: Measuring the release of inorganic phosphate following uppP-catalyzed hydrolysis of undecaprenyl diphosphate

  • Radiometric Assays: Using radiolabeled substrates to track the conversion of undecaprenyl diphosphate to undecaprenyl phosphate

  • Coupled Enzyme Assays: Linking phosphate release to secondary reactions that produce measurable signals

Inhibition Studies:

  • IC50 determination using dose-response curves with potential inhibitors

  • Enzyme kinetics to determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Structure-activity relationship (SAR) studies to optimize inhibitor properties

By analogy with UPPS inhibition studies, researchers might expect IC50 values in the low micromolar range for effective inhibitors, with potential for Ki values in the nanomolar range for highly optimized compounds .

How does uppP function in the broader context of bacterial cell wall synthesis?

UppP functions as a critical enzyme in the complex pathway of bacterial cell wall synthesis:

  • Undecaprenyl diphosphate synthase (UPPS) catalyzes the formation of undecaprenyl diphosphate

  • UppP dephosphorylates undecaprenyl diphosphate to produce undecaprenyl phosphate

  • Undecaprenyl phosphate serves as a lipid carrier for peptidoglycan precursors

  • These carriers facilitate the transport of cell wall building blocks across the cytoplasmic membrane

  • After the building blocks are incorporated into the growing peptidoglycan layer, undecaprenyl diphosphate is regenerated

  • UppP then recycles this molecule back to undecaprenyl phosphate, maintaining the supply of lipid carriers

This cycle is essential for continuous cell wall synthesis and bacterial growth. Disruption of this pathway at any step, including uppP function, can compromise cell wall integrity and potentially lead to bacterial cell death.

How can structural data on uppP inform antimicrobial drug development?

Structural insights into uppP can significantly advance antimicrobial drug development through several approaches:

  • Structure-Based Drug Design: Understanding the three-dimensional structure of uppP, particularly its active site, can guide the design of specific inhibitors that block its enzymatic function.

  • Binding Site Identification: Computational methods can identify potential binding pockets beyond the active site that might be exploited for allosteric inhibition.

  • Selectivity Enhancement: Structural comparison between bacterial uppP and human phosphatases can highlight differences that allow for the development of selective inhibitors with minimal off-target effects.

  • Synergistic Drug Development: Similar to the approach used with UPPS inhibitors, which showed synergistic effects with existing antibiotics (e.g., a rhodanine compound exhibited a fractional inhibitory concentration index of 0.1 with methicillin against MRSA USA300), uppP inhibitors might potentiate the effects of current antibiotics .

The development of effective uppP inhibitors could potentially address resistance to current cell wall-targeting antibiotics and provide new options for treating infections caused by resistant pathogens.

What experimental models are most suitable for studying uppP inhibition in L. hongkongensis?

Based on methodologies used in similar research areas, the following experimental models would be appropriate for studying uppP inhibition in L. hongkongensis:

In Vitro Models:

  • Purified Enzyme Assays: Using recombinantly expressed and purified uppP to directly measure inhibition of enzymatic activity

  • Membrane Preparations: Isolating bacterial membranes containing native uppP to assess inhibition in a more natural environment

  • Whole-Cell Assays: Determining minimum inhibitory concentrations (MICs) of potential inhibitors against L. hongkongensis

Molecular and Genetic Models:

  • Gene Knockout/Knockdown Studies: Creating uppP-deficient or depleted strains to validate the enzyme as an essential target

  • Overexpression Models: Overexpressing uppP to determine if this confers resistance to potential inhibitors

  • Site-Directed Mutagenesis: Introducing specific mutations to identify critical residues for catalysis and inhibitor binding

For evaluation of inhibitor efficacy, researchers could follow approaches similar to those used for UPPS inhibitors, which demonstrated MIC or IC50 values in the 0.25-4 μg/mL range against various bacteria, including antibiotic-resistant strains .

What are the major technical challenges in researching L. hongkongensis uppP?

Research on L. hongkongensis uppP faces several technical challenges:

  • Membrane Protein Expression: As an integral membrane protein, uppP is challenging to express in recombinant systems at high yields while maintaining proper folding and activity.

  • Purification Difficulties: Membrane proteins require detergents or other solubilizing agents for extraction and purification, which can affect protein stability and function.

  • Assay Development: Developing sensitive and specific assays for uppP activity requires careful consideration of substrate availability and detection methods.

  • Structural Determination: Obtaining high-resolution structural data for membrane proteins like uppP is technically demanding and may require specialized techniques such as cryo-electron microscopy.

  • Specificity of Inhibitors: Designing inhibitors that target L. hongkongensis uppP specifically without affecting host phosphatases presents a significant challenge.

How might genomic and proteomic approaches advance our understanding of uppP in L. hongkongensis?

Advanced genomic and proteomic approaches offer powerful tools for investigating uppP in L. hongkongensis:

Genomic Approaches:

  • Comparative Genomics: Analyzing uppP sequences across different L. hongkongensis strains and related bacterial species to identify conserved regions and potential functional domains

  • Transcriptomic Analysis: Using RNA-seq to determine expression patterns of uppP under various conditions, including antibiotic exposure

  • CRISPR-Cas9 Editing: Employing gene editing to create specific mutations in uppP for functional studies

Proteomic Approaches:

  • Interactome Analysis: Identifying protein-protein interactions involving uppP to understand its broader functional network

  • Post-Translational Modifications: Characterizing potential modifications that might regulate uppP activity

  • Structural Proteomics: Using techniques like hydrogen-deuterium exchange mass spectrometry to probe protein dynamics and conformation

These approaches could provide valuable insights into how uppP functions within the larger context of bacterial physiology and potentially reveal new strategies for therapeutic intervention.

What emerging research directions might lead to novel applications of L. hongkongensis uppP studies?

Several promising research directions could expand the applications of L. hongkongensis uppP studies:

  • Combination Therapy Development: Similar to the synergistic effects observed with UPPS inhibitors and existing antibiotics, uppP inhibitors might be developed as adjuvants to restore sensitivity to current antibiotics .

  • Broad-Spectrum Applications: Understanding the structural similarities and differences between uppP from various bacterial species could facilitate the development of broad-spectrum inhibitors targeting multiple pathogens.

  • Diagnostic Applications: Knowledge of uppP function and expression could potentially be leveraged for developing diagnostic tools for L. hongkongensis identification.

  • Structural Biology Advances: Detailed structural studies of uppP could contribute to the broader field of membrane protein research, potentially improving expression and purification methodologies.

  • Antimicrobial Resistance Surveillance: Understanding the role of uppP in antimicrobial resistance could inform surveillance strategies for tracking resistance mechanisms in clinical settings.

These directions highlight the potential for uppP research to contribute not only to basic scientific knowledge but also to practical applications in diagnostic and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.