Recombinant Lasionycteris noctivagans Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Lasionycteris noctivagans (Silver-haired bat)
Target Names
Target Protein Sequence
MTNIRKSHPLLKIINNSFIDLPAPSNISSWWNFGSLLGICLALQILTGIFLAMHYTSDTA TAFNSVTHICRDVNYGWVLRYLHANGASMFFICLYLHVGRGLYYGSYMYKETWNMGVILL FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Lasionycteris noctivagans cytochrome b and what is its significance in molecular studies?

Lasionycteris noctivagans cytochrome b (MT-CYB) is a mitochondrial protein encoded by the MTCYB gene located in the mitochondrial DNA. This protein serves as a critical component of the electron transport chain, specifically in Complex III (cytochrome bc1 complex). In research contexts, MT-CYB sequences are valuable for:

  • Species identification and authentication in taxonomic studies

  • Phylogenetic analysis of bat populations and related species

  • Molecular epidemiology investigations, particularly in virus-host relationship studies

  • Evolutionary biology research examining genetic diversity among chiropteran species

The gene encoding cytochrome b is highly conserved yet contains sufficient variability to be useful in species differentiation, making it an excellent molecular marker. Researchers commonly sequence approximately 893 bp of the cytochrome b gene for comparison with reference sequences available in repositories such as GenBank .

How is recombinant Lasionycteris noctivagans MT-CYB typically produced for research purposes?

Production of recombinant L. noctivagans MT-CYB typically follows this methodological workflow:

  • Sample collection and RNA extraction: Tissue samples (often muscle) are collected from authenticated L. noctivagans specimens, and total RNA is extracted using commercially available reagents like TRIzol.

  • cDNA synthesis: First-strand cDNA is generated using random primers and reverse transcriptase enzymes, as demonstrated in viral studies involving L. noctivagans .

  • PCR amplification: The MT-CYB coding sequence is amplified using specific primers designed to target conserved regions flanking the gene. PCR conditions typically involve:

    • Initial denaturation (94°C, 5 minutes)

    • 30-35 cycles of: denaturation (94°C, 30 seconds), annealing (55-58°C, 30 seconds), extension (72°C, 60 seconds)

    • Final extension (72°C, 7 minutes)

  • Cloning: The amplified fragment is inserted into an appropriate expression vector containing:

    • Strong promoter (T7, CMV)

    • Affinity tag (His-tag, GST)

    • Selection marker (ampicillin resistance)

  • Expression system: The recombinant construct is transformed into an expression system, with E. coli being the most common for initial studies, though mammalian or insect cell systems may be preferred for functional studies due to proper folding and post-translational modifications.

  • Induction and expression: Protein expression is induced using appropriate conditions (e.g., IPTG for bacterial systems), followed by cell lysis and protein extraction.

  • Purification: The recombinant protein is purified using affinity chromatography, ion-exchange chromatography, and size exclusion methods.

What verification methods confirm the identity and purity of recombinant MT-CYB?

Verification of recombinant L. noctivagans MT-CYB involves multiple complementary techniques:

  • SDS-PAGE analysis: Assesses protein size and initial purity

  • Western blot: Confirms identity using antibodies against the protein or affinity tag

  • Mass spectrometry: Provides precise molecular weight and sequence information

  • DNA sequencing: Confirms the coding sequence matches the expected L. noctivagans MT-CYB sequence

  • Spectral analysis: Cytochrome b has characteristic absorption spectra (reduced vs. oxidized)

  • Enzyme activity assays: Measures functional parameters if the protein is properly folded

When performing sequence verification, researchers should align the obtained sequence with reference MT-CYB sequences from databases to confirm species authenticity, as done in molecular epidemiological studies of bat species .

What are the optimal primer design strategies for amplifying Lasionycteris noctivagans MT-CYB for recombinant expression?

Designing effective primers for L. noctivagans MT-CYB amplification requires careful consideration of several parameters:

  • Sequence conservation analysis: Compare MT-CYB sequences from L. noctivagans and related bat species to identify conserved regions that flank variable domains. This approach is similar to that used in molecular epidemiology studies of bat viruses where cytochrome b sequencing was employed for species identification .

  • Primer characteristics:

    • Length: 18-30 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C with ≤5°C difference between primer pairs

    • Avoid secondary structures: Check for self-complementarity and hairpin formation

    • Add restriction sites: Include appropriate restriction enzyme recognition sequences with 3-6 additional nucleotides at the 5' end

  • Codon optimization: For efficient expression in the chosen host system, codon usage should be optimized while maintaining the amino acid sequence.

  • Heterologous expression considerations: Include appropriate regulatory elements:

    • Start/stop codons

    • Kozak sequence for eukaryotic expression

    • Fusion tags (His, GST, MBP) with protease cleavage sites

  • Nested PCR approach: For difficult templates, design primers for nested PCR similar to the approach used for viral RNA detection in bat tissues .

Primer Design ComponentRecommendation for L. noctivagans MT-CYB
Forward primer location5' end with start codon (ATG) and restriction site
Reverse primer location3' end with/without stop codon depending on C-terminal tag
GC clampInclude 1-2 G/C at the 3' end for stronger binding
Avoid poly-N stretchesNo more than 4 consecutive identical nucleotides
Terminal restriction sitesAdd NdeI (CATATG) at 5' end and XhoI (CTCGAG) at 3' end
Template sourceTotal DNA from authenticated L. noctivagans tissue

How do mutations in Lasionycteris noctivagans MT-CYB compare to pathogenic mutations in human MT-CYB?

The comparison between mutations in L. noctivagans MT-CYB and human pathogenic mutations provides valuable insights into protein function conservation and evolutionary adaptation:

  • Conserved functional domains: Several regions of cytochrome b are highly conserved across species due to their critical roles in electron transport. Mutations in these regions in humans are associated with pathological conditions such as mitochondrial myopathy, exercise intolerance, and MELAS syndrome .

  • Adaptive versus pathogenic mutations: Mutations that appear in L. noctivagans may represent adaptive changes that have been selected during evolution to optimize energy metabolism for flight and echolocation, while similar mutations in humans might disrupt normal function.

  • Structural impacts: The m.14864T>C mutation in human MT-CYB changes a highly conserved cysteine to arginine (position 40), resulting in disease . Corresponding positions in L. noctivagans MT-CYB can be examined to understand structural requirements across species.

  • Heteroplasmy considerations: In humans, MT-CYB mutations often exhibit heteroplasmy (mixture of mutant and wild-type mtDNA) that varies across tissues, affecting disease expression . Studies of L. noctivagans MT-CYB could examine natural variation across tissues to understand tissue-specific expression patterns.

  • Functional consequences: Human MT-CYB mutations often affect Complex III assembly or function. Recombinant L. noctivagans MT-CYB can be studied to determine if species-specific variations affect these properties.

By analyzing these comparative aspects, researchers can gain insights into both the fundamental biology of cytochrome b and the potential applications in understanding mitochondrial disease mechanisms.

What methodological approaches are most effective for studying structure-function relationships in recombinant Lasionycteris noctivagans MT-CYB?

To elucidate structure-function relationships in recombinant L. noctivagans MT-CYB, researchers should consider the following methodological approaches:

  • X-ray crystallography and cryo-EM:

    • Produce highly purified recombinant protein

    • Optimize buffer conditions for crystal formation

    • Solve structure at high resolution to identify key structural elements

    • Compare with existing structures of cytochrome b from other species

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment

    • Create mutations analogous to those found in human pathological conditions

    • Express mutant forms and assess functional impacts

  • Spectroscopic analysis:

    • UV-visible spectroscopy to analyze heme environments

    • Circular dichroism (CD) to assess secondary structure

    • Fluorescence spectroscopy to examine conformational changes

  • Enzyme kinetics:

    • Measure electron transfer rates under varying conditions

    • Determine substrate affinities and inhibitor sensitivities

    • Compare kinetic parameters between wild-type and mutant forms

  • Molecular dynamics simulations:

    • Model protein behavior in membrane environments

    • Simulate electron transfer processes

    • Predict effects of mutations on protein stability and function

  • Protein-protein interaction studies:

    • Identify interaction partners within Complex III

    • Compare interaction patterns with those of human cytochrome b

    • Assess how species-specific variations affect these interactions

These approaches, when combined, provide a comprehensive understanding of the structural basis for MT-CYB function and how species-specific adaptations in L. noctivagans might influence mitochondrial energy production.

How should experiments be designed to compare native versus recombinant Lasionycteris noctivagans MT-CYB?

Designing robust experiments to compare native and recombinant L. noctivagans MT-CYB requires careful consideration of multiple factors:

  • Sample preparation standardization:

    • Native MT-CYB: Extract mitochondria from fresh L. noctivagans tissue using differential centrifugation; solubilize with appropriate detergents

    • Recombinant MT-CYB: Express in selected system with minimal modifications; remove tags if possible

    • Ensure both preparations have comparable purity (>95%)

  • Functional assays:

    • Electron transfer activity measurements using standardized substrates

    • Oxygen consumption rates in reconstituted systems

    • Inhibitor sensitivity profiles (antimycin A, myxothiazol)

    • Redox potential determinations

  • Structural comparisons:

    • Circular dichroism spectra to compare secondary structure elements

    • Thermal stability assessments

    • Protease sensitivity patterns

    • Spectroscopic properties of bound heme groups

  • Experimental controls:

    • Positive control: Well-characterized cytochrome b from a model organism

    • Negative control: Denatured or inactivated preparations

    • System-specific controls: Empty vector preparations for recombinant systems

  • Statistical design:

    • Minimum of three biological replicates

    • Technical triplicates for each measurement

    • Power analysis to determine sample size requirements

    • Appropriate statistical tests (t-test, ANOVA) with multiple testing correction

  • Potential confounding factors to address:

    • Post-translational modifications present in native but not recombinant protein

    • Lipid environment differences affecting protein conformation

    • Effect of purification methods on protein stability

By systematically addressing these factors, researchers can generate reliable comparative data between native and recombinant forms of L. noctivagans MT-CYB, essential for validating the recombinant protein as a research tool.

What controls are essential when using recombinant Lasionycteris noctivagans MT-CYB in phylogenetic studies?

Phylogenetic studies using recombinant L. noctivagans MT-CYB require rigorous controls to ensure valid evolutionary inferences:

  • Sequence authentication controls:

    • Direct sequencing of the MT-CYB gene from verified L. noctivagans specimens

    • Inclusion of reference sequences from public databases with careful validation

    • Multiple independent samples from different geographical locations to account for intraspecific variation

  • Experimental controls for recombinant protein expression:

    • Verification of the expression construct by sequencing before and after expression

    • Monitoring for potential mutations introduced during the cloning process

    • Expression of known MT-CYB variants in parallel under identical conditions

  • Phylogenetic analysis controls:

    • Inclusion of MT-CYB sequences from closely related bat species

    • Use of appropriate outgroups for tree rooting

    • Comparison of trees generated using different phylogenetic methods (Maximum Likelihood, Bayesian Inference, Neighbor-Joining)

    • Bootstrap analysis or posterior probability assessment to evaluate branch support

  • Methodological controls for species identification:

    • When using cytochrome b for species identification, compare approximately 893 bp of the gene to reference sequences as described in molecular epidemiology studies

    • Include controls for potential PCR artifacts or contamination

    • Incorporate multiple genetic markers beyond MT-CYB for cross-validation

  • Validation through complementary approaches:

    • Compare phylogenetic trees based on MT-CYB with those from nuclear genes

    • Correlate molecular findings with morphological and ecological data

    • Test evolutionary hypotheses using multiple analytical approaches

These controls ensure that phylogenetic inferences based on recombinant L. noctivagans MT-CYB accurately reflect evolutionary relationships rather than methodological artifacts.

How should researchers interpret variations in MT-CYB sequences from different Lasionycteris noctivagans populations?

Interpreting MT-CYB sequence variations across L. noctivagans populations requires a systematic analytical framework:

  • Variation classification:

    • Synonymous vs. non-synonymous substitutions

    • Transitions vs. transversions

    • Variations in functional domains vs. non-functional regions

    • Population-specific vs. widespread polymorphisms

  • Evolutionary pressure analysis:

    • Calculate dN/dS ratios to assess selective pressure

    • Identify sites under positive, negative, or neutral selection

    • Compare patterns with those observed in related bat species

    • Assess conservation across different taxonomic scales

  • Population structure interpretation:

    • Calculate genetic diversity indices (π, θ)

    • Perform neutrality tests (Tajima's D, Fu's Fs)

    • Construct haplotype networks to visualize relationships

    • Estimate gene flow between populations

  • Functional implications assessment:

    • Predict effects of amino acid substitutions on protein structure using in silico tools

    • Map variations onto known functional domains of cytochrome b

    • Compare with pathogenic mutations in human MT-CYB

    • Consider the biochemical properties of substituted amino acids

  • Biogeographic interpretation:

    • Correlate genetic variation with geographic distribution

    • Test isolation-by-distance models

    • Consider historical biogeography and glacial refugia

    • Evaluate potential barriers to gene flow

  • Temporal dynamics consideration:

    • If historical samples are available, assess changes over time

    • Estimate divergence times for distinct lineages

    • Consider the impact of recent environmental changes

This analytical approach allows researchers to extract meaningful biological information from MT-CYB sequence data, contributing to understanding L. noctivagans evolution, population history, and adaptation.

What statistical methods are most appropriate for analyzing kinetic data from recombinant MT-CYB experiments?

Analysis of kinetic data from recombinant L. noctivagans MT-CYB experiments requires specialized statistical approaches to ensure robust interpretation:

  • Enzyme kinetics analysis:

    • Michaelis-Menten curve fitting using non-linear regression

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations for alternative visualizations

    • Calculation of kinetic parameters (Km, Vmax, kcat) with confidence intervals

    • Comparison of different kinetic models (cooperative binding, substrate inhibition) using Akaike Information Criterion (AIC)

  • Statistical comparison of parameters:

    • ANOVA for comparing multiple experimental conditions

    • Student's t-test (paired or unpaired) for comparing two conditions

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

    • Multiple comparison corrections (Bonferroni, Holm-Sidak, FDR) when testing multiple hypotheses

  • Regression analysis for environmental factors:

    • Multiple regression to assess effects of pH, temperature, ionic strength

    • Analysis of covariance (ANCOVA) to compare conditions while controlling for covariates

    • Response surface methodology for optimizing multiple parameters

  • Time-series analysis for stability studies:

    • Linear mixed models for repeated measurements

    • Exponential decay modeling for activity loss over time

    • Arrhenius plots for temperature-dependent processes

  • Outlier detection and handling:

    • Grubbs' test or Dixon's Q-test for identifying statistical outliers

    • Influence analysis using Cook's distance or leverage

    • Robust regression methods for minimizing outlier impacts

Statistical TestApplication in MT-CYB AnalysisRequirements
Two-way ANOVAComparing kinetic parameters across different mutations and conditionsNormal distribution, homogeneity of variance
Extra sum-of-squares F-testDetermining if two datasets can be fit with the same curveNested models
Repeated measures ANOVAAnalyzing time-dependent changes in activitySphericity, no missing data
Bootstrap analysisGenerating confidence intervals for complex parametersSufficient sample size
Permutation testsNon-parametric comparison of kinetic profilesIndependent observations

How can recombinant Lasionycteris noctivagans MT-CYB contribute to bat virus research?

Recombinant L. noctivagans MT-CYB offers several valuable applications in bat virus research:

  • Species authentication in virus surveillance:

    • L. noctivagans is known to harbor rabies virus variants, including the specific isolate LnV1 mentioned in virus pathogenesis studies

    • Recombinant MT-CYB can serve as a positive control for species identification in surveillance programs

    • Antibodies developed against recombinant MT-CYB can be used for tissue identification in virus isolation studies

  • Host-pathogen coevolution studies:

    • Comparison of MT-CYB sequences alongside viral genetics can reveal coevolutionary patterns

    • Recombinant protein can be used to study potential interactions with viral proteins

    • Analysis of selection patterns in MT-CYB may correlate with viral adaptation in L. noctivagans populations

  • Experimental infection model development:

    • MT-CYB expression patterns can serve as markers for metabolic activity in bat cell cultures

    • Recombinant protein can be used to develop L. noctivagans-specific reagents for in vitro studies

    • Antibodies against MT-CYB can help identify tissue tropism in experimental infections

  • Viral isolation and propagation optimization:

    • Understanding metabolic requirements through MT-CYB studies can improve bat cell culture conditions

    • Species-specific markers based on MT-CYB can confirm the origin of bat cell lines used for virus isolation

    • Metabolic profiling using MT-CYB activity can optimize viral growth conditions

  • Reservoir competence assessment:

    • MT-CYB variations may correlate with differences in viral susceptibility among bat populations

    • Functional assays using recombinant MT-CYB can assess metabolic impacts of viral infection

    • Species-specific markers can help track virus-host associations in mixed-species colonies

The integration of recombinant L. noctivagans MT-CYB in these applications enhances our understanding of bat-virus ecology and evolution, potentially contributing to improved surveillance and control strategies for zoonotic diseases.

What experimental approaches can assess the impact of environmental factors on recombinant MT-CYB stability and function?

To evaluate how environmental factors affect recombinant L. noctivagans MT-CYB, researchers should consider these methodological approaches:

  • Temperature stability assessment:

    • Incubate purified recombinant MT-CYB at different temperatures (4-60°C)

    • Measure residual activity at regular intervals

    • Determine thermal denaturation midpoint (Tm) using differential scanning calorimetry

    • Assess structural changes with circular dichroism at various temperatures

    • Create Arrhenius plots to determine activation energy for denaturation

  • pH sensitivity analysis:

    • Expose protein to buffer systems spanning pH 4-10

    • Monitor activity, spectral properties, and structural integrity

    • Identify optimal pH range and inflection points for activity loss

    • Compare pH profiles with those of MT-CYB from non-bat species

  • Oxidative stress response:

    • Expose recombinant protein to various reactive oxygen species (H₂O₂, superoxide)

    • Quantify functional changes and structural modifications

    • Identify oxidation-sensitive residues using mass spectrometry

    • Assess potential protective mechanisms

  • Metal ion effects:

    • Test impacts of physiologically relevant ions (Fe²⁺, Cu²⁺, Zn²⁺) on stability and function

    • Determine binding affinities using isothermal titration calorimetry

    • Identify metal-binding sites and their conservation across species

    • Evaluate potential competitive or synergistic effects

  • Freeze-thaw stability:

    • Subject protein to multiple freeze-thaw cycles

    • Assess activity retention and aggregation tendency

    • Optimize cryopreservation formulations

    • Determine long-term storage conditions

  • Detergent compatibility:

    • Test stability in different membrane-mimetic environments

    • Optimize detergent type and concentration for functional studies

    • Compare activity in detergent micelles versus liposome reconstitution

These methodologies help characterize the environmental resilience of recombinant L. noctivagans MT-CYB, providing insights into both basic protein properties and potential adaptation mechanisms in the native organism to different environmental conditions.

How can comparative analysis of MT-CYB across bat species contribute to understanding bat evolution and ecology?

Comparative analysis of MT-CYB across bat species offers powerful insights into evolutionary history and ecological adaptations:

  • Phylogenetic reconstruction:

    • Generate comprehensive phylogenies including L. noctivagans MT-CYB

    • Estimate divergence times between bat lineages

    • Identify instances of convergent evolution

    • Resolve taxonomic uncertainties within Chiroptera

  • Molecular clock applications:

    • Calculate substitution rates in MT-CYB across bat lineages

    • Calibrate evolutionary timescales using fossil data

    • Identify periods of rapid diversification

    • Correlate evolutionary events with historical climate changes

  • Adaptive evolution analysis:

    • Identify sites under positive selection across bat lineages

    • Correlate MT-CYB adaptations with ecological traits (diet, roosting behavior, migration)

    • Compare evolution rates between ecologically diverse bat groups

    • Examine selection pressures in relation to metabolic demands

  • Biogeographic pattern investigation:

    • Map MT-CYB haplotype distribution across geographical ranges

    • Identify historical dispersal routes and barriers

    • Test vicariance versus dispersal hypotheses

    • Reconstruct historical population dynamics

  • Ecological niche correlation:

    • Associate MT-CYB variants with ecological parameters

    • Compare metabolic adaptations across bat species with different feeding strategies

    • Examine altitude adaptations in MT-CYB structure and function

    • Investigate temperature adaptation signatures in hibernating versus non-hibernating species

  • Conservation applications:

    • Develop MT-CYB markers for species identification in conservation monitoring

    • Assess genetic diversity in endangered bat populations

    • Identify evolutionary significant units for conservation prioritization

    • Monitor hybridization between closely related species

Through these approaches, MT-CYB comparative analysis contributes substantially to our understanding of bat biology, ecology, and evolution, while also providing practical tools for conservation and biodiversity assessment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.