Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPC; GP-C; Pre-glycoprotein polyprotein GP complex; Pre-GP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
260-491
Protein Length
partial
Species
Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)
Target Names
GPC
Target Protein Sequence
GTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAKCNEKHDEEFCDMLRLFDFN KQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMGIPYCNYSKYWYLNHTTTGR TSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYMERQGKTPLGLVDLFVFSTS FYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLYKQPGVPVKWKR
Uniprot No.

Target Background

Function
This recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC) interacts with the host receptor, mediating viral attachment to host receptor alpha-dystroglycan (DAG1). This interaction triggers virion internalization primarily through clathrin- and caveolin-independent endocytosis. As a class I viral fusion protein, it facilitates fusion between viral and host endosomal membranes, delivering the nucleocapsid into the cytoplasm. Membrane fusion is driven by irreversible conformational changes induced by endosomal acidification. The stable signal peptide (SSP) is cleaved, functioning as a signal peptide and remaining as part of the GP complex. The SSP is crucial for efficient glycoprotein expression, post-translational maturation and cleavage of GP1 and GP2, glycoprotein transport to the cell surface, infectious virion formation, and acid pH-dependent glycoprotein-mediated cell fusion.
Gene References Into Functions
  1. Studies suggest that the alpha-dystroglycan binding site on Lassa virus GP1 resides within the central core of the GP trimer. PMID: 28679759
  2. A unique triad of histidines in Lassa Virus GP1 constitutes a binding site for host LAMP1. PMID: 25972533
  3. Evidence implicates GP1 as a chaperone for proper GP2 processing and trafficking to the cell surface, highlighting the role of the native GPC SP in this process. PMID: 19105844
Database Links

KEGG: vg:956585

Protein Families
Arenaviridae GPC protein family
Subcellular Location
[Glycoprotein G1]: Virion membrane; Peripheral membrane protein. Host endoplasmic reticulum membrane; Peripheral membrane protein. Host Golgi apparatus membrane; Peripheral membrane protein. Host cell membrane; Peripheral membrane protein.; [Glycoprotein G2]: Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.; [Stable signal peptide]: Virion membrane; Multi-pass membrane protein. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein.

Q&A

What is the composition of the Lassa virus glycoprotein complex?

The Lassa virus (LASV) glycoprotein complex (GP-C) consists of three main components: glycoprotein 1 (GP1), glycoprotein 2 (GP2), and a stable signal peptide (SSP). GP1 and GP2 form the virion spikes on the surface of the virus particle. The glycoprotein spike trimers connect to the underlying viral matrix. The SSP is retained as the third component of the GP complex after cleavage and helps stabilize the spike complex in its native conformation . This tripartite structure is essential for viral infectivity and represents a unique feature of arenaviruses compared to other enveloped viruses.

What are the functional roles of each component in the GPC?

Each component of the GPC serves distinct functions during viral infection:

  • Stable Signal Peptide (SSP): Unlike typical signal peptides that are degraded after protein translocation, the LASV SSP is retained and required for efficient glycoprotein expression, post-translational maturation cleavage of G1 and G2, glycoprotein transport to the cell surface plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion .

  • Glycoprotein 1 (GP1): Forms the receptor-binding domain that mediates virus attachment to the host primary receptor alpha-dystroglycan (DAG1) at the cell surface. This attachment induces virion internalization through macropinocytosis .

  • Glycoprotein 2 (GP2): Functions as a class I viral fusion protein that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversible conformational changes induced by acidification of the endosomal compartment .

How do recombinant Lassa virus glycoproteins differ from native forms?

  • Soluble forms of GP1 and GP2 may be engineered by removing transmembrane domains or adding fusion tags for purification purposes

  • Chimeric constructs (such as Fc fusions) may be created to facilitate detection and purification

  • Signal sequence modifications may be introduced to enhance expression

  • Reporter genes or epitope tags may be incorporated for visualization and tracking

Research shows that uncoupling GP1 and GP2 expression affects protein processing, as GP1 appears to function as a chaperone for the correct processing and shuttling of GP2 to the cell surface .

What mechanisms govern the interaction between LASV GP-C and host cell receptors?

The interaction between LASV GP-C and host cell receptors involves a multi-step process with receptor switching:

Initially, LASV GP1 mediates virus attachment to alpha-dystroglycan (α-DG) at the cell surface, which serves as the primary receptor. Following attachment, the virion is internalized through macropinocytosis. Inside the endosome, a pH-dependent switch occurs where binding shifts from α-DG to the lysosomal-associated membrane protein 1 (LAMP1) .

Research demonstrates that this receptor switch is critical for infection. The ST3 beta-galactoside alpha-2,3-sialyltransferase 4 (ST3GAL4) plays an important role in this interaction between LASV GP-C and human LAMP1. Analysis shows that of the 11 glycosylated asparagine sequons of human LAMP1, nine have sialylated glycan caps that mediate LASV GP-C interaction, exceeding the recommended glycosylation threshold of 0.5 .

This binding to LAMP1 triggers the dissociation of GP1, exposing the GP2 fusion subunit to facilitate membrane fusion between the viral envelope and the endosomal membrane . This complex entry mechanism represents a potential target for therapeutic intervention.

How does the stable signal peptide (SSP) influence GPC processing and function?

The stable signal peptide (SSP) in LASV GPC plays multiple critical roles beyond typical signal sequence functions:

  • Complex stabilization: SSP is retained after cleavage and helps stabilize the spike complex in its native conformation rather than being degraded like conventional signal peptides .

  • Maturation assistance: Studies show that SSP is required for efficient post-translational maturation cleavage of GP1 and GP2, suggesting it functions as a chaperone during protein folding and processing .

  • Transport facilitation: Expression studies indicate that the native GPC signal peptide plays a role in the correct processing and shuttling of GP2 to the cell surface .

  • Fusion regulation: The SSP is essential for acid pH-dependent glycoprotein-mediated cell fusion, likely by influencing the conformational changes necessary for fusion activity .

  • Virion assembly: Research demonstrates that SSP is required for the formation of infectious virus particles, indicating a role in the structural organization of mature virions .

When GP2 is expressed without GP1 and the native GPC signal peptide, it may be processed through an alternate pathway that produces heterogeneously glycosylated protein, or the polypeptide may not fully mature in the secretory cascade in mammalian cells .

What are the implications of GP1 ectodomain shedding during LASV infection?

The observation of GP1 ectodomain shedding from cells expressing wild-type LASV GPC has significant implications for pathogenesis and diagnostics:

  • Disease progression markers: GP1 shedding establishes new correlates of disease progression that could be monitored in patient serum samples to track infection severity and response to treatment .

  • Immune evasion: Shed GP1 may act as a decoy that binds to neutralizing antibodies, potentially helping the virus evade immune responses.

  • Diagnostic opportunities: Detection of soluble GP1 in patient samples provides opportunities for developing early diagnostic tests targeting the initial stages of Lassa fever .

  • Receptor competition: Released GP1 may compete with virions for cellular receptors, potentially modulating infection dynamics within the host.

  • Therapeutic implications: Understanding this process could facilitate the development of targeted interventions that either prevent GP1 shedding or neutralize its effects.

The molecular mechanisms controlling GP1 shedding and its precise roles during various stages of infection remain areas requiring further investigation and represent potential targets for therapeutic development .

What expression systems are optimal for producing recombinant LASV glycoproteins?

The choice of expression system for producing recombinant LASV glycoproteins depends on the research objectives, with mammalian systems generally preferred for maintaining native properties:

Mammalian Expression Systems:

  • HEK293 Cells: Often used for recombinant LASV glycoprotein expression, providing >95% purity and proper post-translational modifications .

  • Signal Sequence Considerations: Both native GPC signal peptide and heterologous signal sequences (such as human IgG) can be used to direct protein secretion, though the native signal may influence proper processing .

  • Co-expression Requirements: For soluble GP2 production, co-expression with GP1 is necessary for proper processing and secretion .

Key Modifications for Expression:

  • Deletion of transmembrane domains for secreted versions

  • Addition of purification tags (His, Fc chimeras)

  • Intracellular domain fusion to the ectodomain for GP2 to achieve secretion

  • Reporter gene introduction for tracking expression

Research indicates that when expressing GP2, it must be co-expressed with a complete GP1 gene to achieve proper processing and secretion . Additionally, the native GPC signal peptide plays a role in the correct processing of GP2, suggesting specific sequences in expression constructs influence protein maturation pathways.

How can reporter-encoding recombinant Lassa viruses be generated and utilized?

Generation and utilization of reporter-encoding recombinant Lassa viruses involve several specialized techniques:

Generation Method:

  • Reverse Genetics System: Four plasmids are typically used - two expressing viral proteins (pCAGGS-LASV-NP, pCAGGS-LASV-L) and two containing genomic segments (mPol-I/LASV-Sag, mPol-I/LASV-Lag) .

  • Reporter Gene Insertion: A cleavable GFP construct is incorporated into the viral genome, allowing expression during viral replication while maintaining viral function .

  • Cell Culture Rescue: Transfection of plasmids into permissive cells followed by recovery of infectious particles.

Applications:

  • High-throughput Drug Screening: Reporter viruses facilitate rapid quantification of infection inhibition by candidate compounds .

  • Neutralization Assays: Provide straightforward methods for detecting LASV-neutralizing antibodies based on reporter expression .

  • Viral Entry Studies: Enable visualization of early infection events through fluorescence microscopy.

  • In vivo Pathogenesis: When used in animal models, allow tracking of viral spread and tissue tropism.

Important Considerations:

  • Growth Kinetics: Reporter viruses (rLASV-GFP) may show slightly impaired growth compared to wild-type LASV .

  • Genetic Stability: Stability of GFP expression can vary during serial passages and is influenced by the choice of cell line .

  • Biosafety: Work with reporter LASV requires maximum containment/biosafety level 4 facilities .

Research at facilities like the US Integrated Research Facility at Fort Detrick has established these systems as valuable tools for various high-consequence viral pathogen research applications .

What methods are effective for analyzing LASV glycoprotein interactions with host receptors?

Analyzing LASV glycoprotein interactions with host receptors requires specialized techniques that can detect and characterize these molecular interactions:

Biochemical Methods:

  • Co-immunoprecipitation: To isolate GPC-receptor complexes from cell lysates

  • Surface Plasmon Resonance: For measuring binding kinetics between purified GP1 and receptors

  • ELISA-based Binding Assays: Using recombinant GP1 and soluble receptor domains

Structural Methods:

  • Cryo-electron Microscopy: To visualize GPC-receptor complexes

  • X-ray Crystallography: For atomic-resolution structures of binding interfaces

  • Hydrogen-Deuterium Exchange Mass Spectrometry: To map interaction surfaces

Cellular Methods:

  • Receptor Competition Assays: Using antibodies or soluble ligands to block specific interactions

  • Flow Cytometry: To quantify binding of recombinant GP1 to cells expressing receptors

  • Glycosylation Analysis: Particularly for studying sialylated glycans on LAMP1 that mediate LASV GP-C interaction

Network Analysis Approaches:
Recent studies have employed weighted network analysis to infer function annotations and molecular mediators characterizing LASV infection. This revealed that glycoprotein sialylation, sialyltransferase enzymatic activities, and glycosphingolipid biosynthesis are linked with ST3GAL4 function in mediating LASV-LAMP1 interactions .

Research has demonstrated that of the 11 glycosylated asparagine sequons of human LAMP1, nine have sialylated glycan caps that exceed the glycosylation threshold of 0.5 and mediate the molecular recognition between LASV and LAMP1 .

How should researchers interpret differences in glycosylation patterns of recombinant versus native LASV glycoproteins?

Differences in glycosylation patterns between recombinant and native LASV glycoproteins require careful interpretation:

Key Interpretation Guidelines:

  • Expression System Influence: Mammalian cells (like HEK293) typically produce more native-like glycosylation compared to other systems. Differences observed may reflect the specific glycosylation machinery of the expression host .

  • Functional Impact Assessment: Researchers should evaluate whether glycosylation differences affect key functions such as:

    • Receptor binding affinity

    • Protein stability and folding

    • Immunogenicity and epitope accessibility

    • Fusion activity for GP2

  • N-linked vs. O-linked Glycosylation: Distinguishing between types of glycosylation modifications is essential. N-linked glycosylation plays a critical role in LAMP1-GP interaction through sialylated caps .

  • Heterogeneity Analysis: Recombinant GP2 expressed without GP1 and native GPC signal peptide shows heterogeneous glycosylation, suggesting incomplete maturation in the secretory pathway .

  • Site-specific Evaluation: Since not all glycosylation sites are functionally equivalent, site-specific analysis is necessary. For example, with LAMP1, only 9 of 11 sites have sialylated glycan caps that mediate GP-C interaction .

Researchers should use complementary methods (mass spectrometry, lectin binding, glycosidase treatments) to thoroughly characterize glycan structures and their functional implications. When discrepancies are found, validation with native virus-derived material or pseudotyped particles may be necessary to confirm biological relevance.

What can be learned from stability studies of reporter-expressing recombinant LASV?

Stability studies of reporter-expressing recombinant LASV provide crucial insights for both fundamental virology and practical applications:

Key Learnings and Implications:

  • Viral Evolution Dynamics:

    • Reporter gene maintenance or loss during serial passages reveals selection pressures acting on the viral genome

    • Cell type influences genetic stability, indicating host factors affect viral replication fidelity

  • Optimal Experimental Design:

    • The choice of cell line is critical for maintaining reporter stability in drug screening applications

    • Passage number should be carefully controlled and documented in experimental protocols

    • GFP stability monitoring should be incorporated as a quality control measure

  • Platform Development Guidance:

    • For high-throughput drug screens, protocols must account for potential reporter instability

    • Neutralization antibody assays should include controls to validate reporter expression

    • Maximum containment/biosafety level 4 facilities must establish standardized protocols for reporter viruses

  • Research Applications Limitations:

    • Long-term in vivo studies may be affected by reporter gene loss

    • Slightly impaired growth kinetics of reporter viruses (compared to wild-type) must be considered when interpreting results

These insights are valuable for researchers developing similar reporter systems for other high-consequence pathogens and help establish benchmarks for quality control in antiviral discovery pipelines.

How does the structure-function relationship of LASV GPC inform vaccine and therapeutic design?

Understanding the structure-function relationship of LASV GPC has direct implications for rational vaccine and therapeutic design:

Vaccine Design Implications:

  • Antigen Presentation Strategy:

    • The tripartite nature of GPC (GP1, GP2, SSP) suggests vaccines should preserve complex epitopes spanning these components

    • GP1 ectodomain shedding indicates that stabilized forms preventing shedding may induce more effective immune responses

    • Live attenuated vaccine candidates like rLASV/IGR-CD have shown protection in guinea pig models

  • Neutralizing Epitope Targeting:

    • Structural knowledge of receptor-binding domains in GP1 helps focus vaccine design on blocking critical interactions

    • Understanding the conformational changes during receptor switching from DAG1 to LAMP1 reveals transient epitopes that may be targeted

Therapeutic Design Approaches:

  • Entry Inhibitor Development:

    • The pH-dependent switch from DAG1 to LAMP1 binding represents a vulnerable point for inhibitor design

    • Sialylated glycan interactions between GP-C and LAMP1 offer specific targets for inhibitory molecules

  • Fusion Inhibitor Strategies:

    • GP2's role as a class I fusion protein suggests parallels with HIV fusion inhibitors

    • Targeting the conformational changes induced by acidification could block membrane fusion

  • Host Enzyme Modulation:

    • ST3GAL4's role in the sialylation process affecting LASV-LAMP1 interaction presents a potential host-targeted approach

    • Proprotein convertase inhibition might affect GPC processing and virion production

Research indicates that understanding the complex interactions between the SSP, glycoprotein processing pathways, and the glycoprotein complex facilitates generating effective prophylactic and therapeutic strategies . The live-attenuated vaccine candidate rLASV/IGR-CD, which grows to high titers in cells approved for human vaccine production and has demonstrated protection in animal models, represents a promising application of this knowledge .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.