Recombinant Latimeria chalumnae Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To prioritize a specific tag type, please inform us during your order.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Latimeria chalumnae (West Indian ocean coelacanth)
Target Names
Target Protein Sequence
MAHPSQLGLQDAASPVMEELLHFHDHALMIVFLISTLVFYIILAMMTTKMTDKYILDAQE IEIVWTLLPAIVLILVALPSLRILYLIDEVENPHLTIKAMGHQWYWSYEYTDYEELSFDS YMTPLQDLNPGQFRLLETDHRMVIPMESLIRVLISAEDVLHSWAVPALGVKMDAVPGRLN QITFMISRPGLYYGQCSEICGANHSFMPIVLEAIPLDPFEDWSSSMLEEAX
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC, formed by heme A3 and CuB) in subunit 1. The BNC uses four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of studying Latimeria chalumnae MT-CO2?

Latimeria chalumnae (West Indian ocean coelacanth) is often referred to as a "living fossil" since it belongs to an ancient lineage of lobe-finned fish that was thought extinct for 65 million years before its rediscovery . As a sarcopterygian, coelacanths are more closely related to lungfish and tetrapods than to ray-finned fish, occupying a unique evolutionary position . The MT-CO2 gene encodes the second subunit of cytochrome c oxidase (Complex IV), a critical enzyme in the mitochondrial electron transport chain.

The biological significance of studying this protein includes:

  • Evolutionary insights: MT-CO2 contains crucial functional domains including the dinuclear copper A center (CuA) that receives electrons from cytochrome c . Comparing sequence conservation across species can reveal evolutionary constraints on this essential respiratory enzyme.

  • Insight into mitochondrial function: MT-CO2 contributes to cytochrome-c oxidase activity, involved in mitochondrial electron transport from cytochrome c to oxygen .

  • Biomedical relevance: MT-CO2 mutations in humans can lead to cytochrome c oxidase deficiency, causing various pathologies affecting skeletal muscles, heart, brain, or liver .

What structural features are essential for functional recombinant Latimeria chalumnae MT-CO2?

Functional recombinant Latimeria chalumnae MT-CO2 must retain several critical structural elements:

  • Transmembrane domains: MT-CO2 contains transmembrane alpha-helices in its N-terminal domain that anchor it in the mitochondrial inner membrane . These hydrophobic regions are essential for proper orientation within the mitochondrial membrane.

  • CuA center: The protein contains a binuclear copper A center (CuA), which is the primary electron acceptor from cytochrome c . Based on homology with human MT-CO2, this center likely involves:

    • Conserved cysteine residues (corresponding to positions 196 and 200 in human MT-CO2)

    • Conserved histidine residue (corresponding to position 204 in human MT-CO2)

  • Interface regions: MT-CO2 must maintain proper interfaces with other subunits of cytochrome c oxidase, particularly subunit 1 (MT-CO1), which contains heme A and the binuclear center of heme a3 and copper B .

  • Cytochrome c binding site: The domain that interacts with the mobile electron carrier cytochrome c must be preserved for electron transfer functionality .

When producing recombinant protein, these structural features must be maintained through appropriate expression systems, purification methods, and storage conditions. The protein should be stored at -20°C or -80°C in a Tris-based buffer with 50% glycerol . Repeated freezing and thawing should be avoided to maintain structural integrity.

What are the methodological approaches for expressing and purifying recombinant Latimeria chalumnae MT-CO2?

Expression and purification of recombinant Latimeria chalumnae MT-CO2 presents several technical challenges due to its hydrophobic transmembrane domains and the need for proper incorporation of the CuA center. Based on available research protocols, the following methodological approaches are recommended:

Purification Strategy:

  • Affinity chromatography: Adding an N-terminal or C-terminal His-tag allows purification using metal affinity chromatography .

  • Buffer considerations: The purification buffer should contain:

    • Mild detergents for solubilizing membrane domains

    • Stabilizing agents such as glycerol

    • Copper ions to ensure proper formation of the CuA center

  • Quality control:

    • SDS-PAGE to verify size and purity

    • Western blotting for identity confirmation

    • Mass spectrometry for sequence verification

Storage and Stability:

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage .

  • Avoid repeated freeze-thaw cycles .

  • Working aliquots can be stored at 4°C for up to one week .

A successful expression might yield approximately 50 μg of purified protein, with purity exceeding 95% when analyzed by SDS-PAGE .

How can researchers assess the functional integrity of recombinant Latimeria chalumnae MT-CO2?

Assessing the functional integrity of recombinant Latimeria chalumnae MT-CO2 requires multiple complementary approaches:

Structural Integrity Assessment:

  • Spectroscopic Analysis:

    • UV-visible spectroscopy to detect characteristic absorption spectra of the CuA center

    • Circular dichroism to evaluate secondary structure content

    • Electron paramagnetic resonance (EPR) spectroscopy to characterize the CuA center

  • Metal Content Analysis:

    • Atomic absorption spectroscopy to quantify copper content

    • ICP-MS to determine the copper-to-protein ratio, which should approach 2:1 for the binuclear CuA center

Functional Activity Tests:

  • Electron Transfer Assays:

    • Measure electron transfer from reduced cytochrome c using spectrophotometric methods

    • Monitor the oxidation rate of cytochrome c at 550 nm

  • Integration into Liposomes:

    • Reconstitute with other cytochrome c oxidase subunits in liposomes

    • Measure oxygen consumption using polarographic methods

  • Binding Studies:

    • Surface plasmon resonance to assess interaction with cytochrome c

    • Co-immunoprecipitation studies to verify interaction with other subunits

Applications in Research:

  • ELISA-based assays for antigen-antibody interactions

  • Western blotting for detection and quantification

  • Functional complementation in cellular models of cytochrome c oxidase deficiency

By combining these approaches, researchers can comprehensively assess whether the recombinant protein maintains its native structure and function, particularly the critical electron transfer capability of the CuA center.

What insights can mitochondrial genomic studies of Latimeria chalumnae provide about MT-CO2 evolution?

Mitochondrial genomic studies of Latimeria chalumnae offer unique perspectives on MT-CO2 evolution due to the coelacanth's position as a "living fossil" with a slow evolutionary rate:

Evolutionary Rate Analysis:

Studies comparing mitochondrial DNA between Latimeria chalumnae and Latimeria menadoensis have revealed sequence divergence of approximately 4.1% . This level of divergence allows researchers to:

  • Calculate evolutionary rates for MT-CO2 compared to other mitochondrial genes

  • Identify regions under purifying selection versus those experiencing neutral evolution

  • Compare substitution patterns with those in other vertebrate lineages

Phylogenetic Insights:

The unique evolutionary position of coelacanths provides reference points for understanding:

  • Ancestral states of MT-CO2 in the common ancestor of lobe-finned fishes and tetrapods

  • Lineage-specific adaptations in different vertebrate groups

  • The tempo and mode of molecular evolution in deep vertebrate lineages

Geographical Distribution and Population Genetics:

Mitochondrial DNA sequencing of coelacanths caught off the coast of southern Tanzania suggests a divergence between African populations approximately 200,000 years ago . This contradicts the theory that the Comoros population is the main population with others representing recent offshoots, suggesting a more complex evolutionary history.

Molecular Clock Applications:

The estimated divergence time between the two Latimeria species ranges from 1.8 to 11.0 million years ago, depending on the substitution rate assumed . This relatively recent divergence compared to the ancient origin of coelacanths suggests that MT-CO2 could be evolving at a slow rate, making it valuable for calibrating molecular clocks in vertebrate evolution studies.

How does Latimeria chalumnae MT-CO2 contribute to our understanding of mitochondrial diseases?

Studying Latimeria chalumnae MT-CO2 contributes significantly to our understanding of mitochondrial diseases through comparative and evolutionary approaches:

Identification of Conserved Functional Domains:

By comparing MT-CO2 sequences across evolutionarily distant species like coelacanths and humans, researchers can identify highly conserved regions that have remained unchanged for hundreds of millions of years. These regions likely represent functionally critical domains where mutations would be particularly deleterious .

Disease-Associated Mutations:

Human MT-CO2 mutations can cause cytochrome c oxidase deficiency, a genetic condition affecting multiple organ systems . Studying the equivalent positions in coelacanth MT-CO2 can:

  • Help predict the functional impact of novel mutations

  • Identify compensatory mechanisms that might exist in different species

  • Reveal regions where even conservative amino acid substitutions are not tolerated

Relevance to MELAS Syndrome:

MT-CO2 has been associated with MELAS syndrome (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes) . Evolutionary analysis using the coelacanth sequence can:

  • Identify positions where disease-causing mutations occur in highly conserved regions

  • Suggest potential therapeutic approaches based on functional conservation

  • Provide insight into the structural consequences of pathogenic variants

Biomarker Development:

MT-CO2 has been identified as a biomarker for conditions including Huntington's disease and stomach cancer . Comparative studies with coelacanth MT-CO2 can identify:

  • Conserved epitopes for antibody development

  • Species-specific regions for differential diagnosis

  • Evolutionarily stable peptides suitable for biomarker assay development

The slow evolutionary rate of coelacanth proteins makes them particularly valuable reference points for distinguishing functionally critical residues from those that can vary without severe consequences, directly informing our understanding of mitochondrial disease pathogenesis.

What are the challenges in studying the interaction between recombinant Latimeria chalumnae MT-CO2 and other components of the respiratory chain?

Studying interactions between recombinant Latimeria chalumnae MT-CO2 and other respiratory chain components presents several methodological challenges:

Species-Specific Compatibility Issues:

  • Cross-species interaction limitations: Recombinant coelacanth MT-CO2 may have evolved specific interaction interfaces that are incompatible with respiratory chain components from model organisms. This presents challenges when attempting to:

    • Reconstitute functional cytochrome c oxidase complexes

    • Study electron transfer between species-specific components

    • Interpret interaction data in cellular complementation assays

  • TFAM interactions: Research has shown that coelacanth TFAM (mitochondrial transcription factor A) cannot fully support human mitochondrial DNA replication . Similar species-specific constraints may exist for MT-CO2 interactions, requiring careful experimental design.

Technical Challenges:

  • Maintaining native conformation: The hydrophobic transmembrane domains of MT-CO2 require specialized conditions to maintain proper folding:

    • Detergent selection is critical for solubilization without denaturation

    • Lipid composition affects protein stability and function

    • Buffer conditions must be optimized to maintain copper center integrity

  • Copper center formation: The binuclear CuA center is essential for electron transfer . Ensuring proper formation of this center in recombinant protein requires:

    • Copper supplementation during expression or reconstitution

    • Validation of metal incorporation through spectroscopic methods

    • Protection from oxidation during purification and storage

  • Reconstitution challenges: Assembling a functional complex requires:

    • Co-expression or sequential addition of multiple subunits

    • Appropriate membrane mimetics (liposomes, nanodiscs)

    • Verification of correct stoichiometry and orientation

Experimental Approaches to Overcome Challenges:

  • GeneSwap methodology: The recently developed GeneSwap approach allows for reverse genetic analysis in situ and could be adapted to study MT-CO2 interactions by:

    • Creating chimeric proteins with domains from different species

    • Performing complementation studies in cells lacking endogenous MT-CO2

    • Isolating specific interaction domains through domain swapping

  • Mitochondrial isolation: Using native mitochondria from Latimeria chalumnae tissues would preserve natural interaction partners but presents logistical challenges due to the rarity and protected status of coelacanths.

  • Hybrid systems: Developing hybrid experimental systems combining coelacanth MT-CO2 with human or mouse partners could provide insights into conserved interaction mechanisms.

How do researchers investigate the role of MT-CO2 in mitochondrial electron transport chain assembly?

Investigating the role of MT-CO2 in mitochondrial electron transport chain assembly requires sophisticated methodological approaches that examine both assembly kinetics and the structural organization of complex IV:

Assembly Pathway Analysis:

  • Pulse-chase experiments: Based on assembly studies described in search result , researchers can:

    • Label newly synthesized MT-CO2 with radioisotopes or fluorescent tags

    • Track its incorporation into assembling complexes over time

    • Identify assembly intermediates through native gel electrophoresis

  • Assembly factor identification: MT-CO2 incorporation likely requires specific assembly factors. Techniques to identify these include:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • Genetic screens for assembly defects

  • Sequential assembly mapping: Based on findings that Cox1p (MT-CO1) acts as a seed around which the full complex is assembled , researchers can determine:

    • When MT-CO2 joins the assembly pathway

    • Which subunits or factors must be present before MT-CO2 incorporation

    • Whether MT-CO2 is required for subsequent assembly steps

Regulation of MT-CO2 Incorporation:

Research on cytochrome c oxidase biogenesis has revealed sophisticated regulatory mechanisms . For MT-CO2 specifically:

  • Translational regulation: Determine whether MT-CO2 synthesis is regulated by the availability of assembly partners, similar to the regulation observed for Cox1p .

  • Post-translational stability: Investigate whether unassembled MT-CO2 is subject to proteolytic degradation.

  • Metal incorporation pathways: Identify the machinery required for copper insertion into the CuA center and how this coordinates with assembly.

  • Dependence on cytochrome c: Research has shown that cytochrome c is required for COX assembly . Investigate whether this requirement involves direct interaction with MT-CO2 or indirect effects through other assembly partners.

What experimental designs can probe the co-evolution of mitochondrial and nuclear genomes using Latimeria chalumnae MT-CO2?

Investigating the co-evolution of mitochondrial and nuclear genomes through the lens of Latimeria chalumnae MT-CO2 requires sophisticated experimental designs that address the unique challenges of studying mitonuclear compatibility:

Chimeric Protein Approaches:

  • Domain-swapping experiments: Based on the GeneSwap approach described in search results , researchers can:

    • Create chimeric proteins with domains from coelacanth and human MT-CO2

    • Express these in cells lacking endogenous MT-CO2

    • Assess compatibility with nuclear-encoded subunits

    • Identify regions responsible for species-specificity

  • Results interpretation: Functional analysis of chimeric constructs can reveal:

    • Domains under co-evolutionary constraint

    • Regions where lineage-specific adaptations have occurred

    • Interaction interfaces critical for complex assembly

Complementation Studies:

  • Cross-species rescue experiments:

    • Express Latimeria chalumnae MT-CO2 in human cells with MT-CO2 deficiency

    • Assess restoration of cytochrome c oxidase activity and complex assembly

    • Compare with partial rescue using chimeric constructs

  • Correlation with evolutionary distance:

    • Test MT-CO2 from species at varying evolutionary distances from humans

    • Determine whether compatibility correlates with phylogenetic relatedness

    • Identify unexpected compatibility patterns suggestive of convergent evolution

Comprehensive Analysis of Interaction Networks:

  • Assembly factor compatibility:

    • Determine whether species-specific assembly factors are required

    • Identify limiting factors in cross-species complementation

    • Map the evolution of assembly pathways across vertebrate lineages

  • Regulatory network analysis:

    • Investigate whether the translational regulation of MT-CO2 differs between species

    • Examine conservation of mechanisms like those described for Cox1p, where synthesis is controlled by assembly partner availability

    • Identify lineage-specific innovations in regulatory mechanisms

Experimental Evidence from Coelacanth TFAM Studies:

Research on coelacanth TFAM provides a methodological template. Studies have shown that:

  • Function separation: Coelacanth TFAM's contributions to mtDNA replication and respiratory chain biogenesis are genetically separable .

  • Humanization experiments: Limited "humanization" of coelacanth TFAM focusing on amino acid residues that make DNA contacts resulted in two variants (Ch13 and Ch22) with different properties :

    • Ch13: Low mtDNA copy number but robust respiration

    • Ch22: High mtDNA copy number but poor respiration

  • Complementary functions: Ch13 and Ch22 complement each other's deficiencies , suggesting complex co-evolutionary constraints.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.