Recombinant Latimeria chalumnae NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant MT-ND6 is synthesized using codon-optimized E. coli expression systems, followed by affinity chromatography (Ni-NTA for His-tag purification) and SDS-PAGE validation . Key production metrics:

ParameterSpecification
Expression HostEscherichia coli
Purity≥85% (SDS-PAGE)
Storage-20°C in Tris/PBS buffer with 50% glycerol
StabilityAvoid repeated freeze-thaw cycles

Lyophilized formats are available for long-term storage, with reconstitution protocols requiring sterile deionized water .

Functional and Research Applications

This recombinant protein serves as a tool for:

  • Enzymatic Assays: Studying NADH dehydrogenase activity and inhibition kinetics .

  • Antibody Development: Immunogen for generating polyclonal antibodies (e.g., ab214224) .

  • Structural Biology: Cryo-EM and X-ray crystallography to resolve Complex I architecture .

  • Evolutionary Studies: Comparative analysis of mitochondrial genes across species .

Research Significance

  • Disease Modeling: Mutations in human MT-ND6 homologs cause Leigh syndrome and dystonia . Recombinant coelacanth MT-ND6 enables cross-species mechanistic studies.

  • Drug Discovery: Target for inhibitors in cancer and neurodegenerative diseases .

  • Mitochondrial Evolution: Insights into the conservation of electron transport chain components across vertebrates .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, kindly specify your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchasing method and location. We kindly request you to contact your local distributors for specific delivery timelines.
As a standard practice, all our proteins are shipped with normal blue ice packs. If you require shipping with dry ice, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To ensure optimal preservation, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-173
Protein Length
full length protein
Species
Latimeria chalumnae (West Indian ocean coelacanth)
Target Names
Target Protein Sequence
MIYFVFVVLMGLVVGLMAVASNPAPYFAALGLVFSAVVGCGFLVGYGGSFLSLVLFLIYL GGMLVVFAYSAALAAEPYPESWGSWSVFLYILVYLFGFLLVGYYCYGWWYDFYWMSLDVF GEMSVLSGDVSGVPMVYSSGGFLLLVTGWVLLLALFVVLEITRGLSRGALRAV
Uniprot No.

Target Background

Function
Recombinant Latimeria chalumnae NADH-ubiquinone oxidoreductase chain 6 (MT-ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered a key component of the minimal assembly required for catalytic activity. Complex I plays a crucial role in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND6 and what is its role in cellular respiration?

MT-ND6 (mitochondrial NADH-ubiquinone oxidoreductase chain 6) is one of seven mitochondrial DNA (mtDNA)-encoded subunits of Complex I in the respiratory chain. It functions as an essential component for electron transport and oxidative phosphorylation. Research has demonstrated that MT-ND6 is particularly important for the assembly and function of Complex I, with mutations leading to serious impairment in oxidative phosphorylation .

Methodologically, this function has been established through studies using frameshift mutations and subsequent analysis of respiratory function. Cell lines with frameshift mutations in the ND6 gene exhibit approximately 90% reduction in malate/glutamate-dependent respiration and a decrease in NADH:Q1 oxidoreductase activity by approximately 99% . These findings confirm the critical nature of this protein in maintaining proper mitochondrial electron transport chain function.

What are the structural and biochemical characteristics of recombinant Latimeria chalumnae MT-ND6?

Recombinant Latimeria chalumnae MT-ND6 refers to the artificially produced protein derived from the West Indian ocean coelacanth (Latimeria chalumnae) . Commercial preparations of this protein typically have these characteristics:

  • Source: Expressed in mammalian cell systems to ensure proper folding and post-translational modifications

  • Purity: Greater than 85% as verified by SDS-PAGE

  • Form: Available as both liquid and lyophilized preparations

  • Enzyme classification: EC 1.6.5.3

  • Alternative names: NADH dehydrogenase subunit 6

The commercially available recombinant protein is typically provided as a partial length protein rather than the full-length native protein, which should be considered when designing experiments . The shelf life varies based on storage conditions: liquid form maintains stability for approximately 6 months at -20°C/-80°C, while the lyophilized form remains stable for up to 12 months at the same temperatures .

How do mutations in the MT-ND6 gene affect mitochondrial function?

Mutations in the MT-ND6 gene can dramatically impair mitochondrial function through several mechanisms:

  • Loss of Complex I assembly: MT-ND6 deficiency causes a failure in the assembly of other mtDNA-encoded subunits of the enzyme complex, indicating its essential structural role .

  • Severe respiratory dysfunction: In cells with ND6 frameshift mutations, polarographic analysis reveals malate/glutamate-dependent respiration is reduced by approximately 90% .

  • Enzymatic activity disruption: NADH:Q1 oxidoreductase activity decreases by about 99% in mitochondrial extracts from MT-ND6 mutant cells .

  • Metabolic adaptation requirements: MT-ND6 deficient cells completely fail to grow in media where glucose is replaced with galactose, indicating a critical impairment in oxidative phosphorylation function and forcing cells to rely solely on glycolysis for ATP production .

These findings from mutation studies provide strong evidence that MT-ND6 plays an essential role in both the structural integrity and functional capacity of Complex I, with far-reaching consequences for cellular bioenergetics when disrupted.

What experimental approaches are most effective for studying MT-ND6 function in cellular models?

Several complementary methodological approaches have proven valuable for investigating MT-ND6 function:

  • Genetic manipulation strategies:

    • Selection schemes based on resistance to rotenone (a specific Complex I inhibitor) to isolate mutants affected in specific ND subunits

    • PCR amplification and sequencing to identify mutations in the ND6 gene

    • Allele-specific termination of primer extension to detect low-level heteroplasmy

  • Mitochondrial transfer techniques:

    • Generation of ρ0 cell lines (mtDNA-less) as recipients for mitochondrial transfer

    • Transfer of mitochondria from mutant cell lines into ρ0 cells to confirm mitochondrial genetic origin of observed defects

    • Verification of mitochondrial transfer through mtDNA sequence analysis in transformants

  • Functional assessment methods:

    • Polarographic analysis to measure respiration rates with specific substrates (e.g., malate/glutamate)

    • Enzymatic assays of NADH:Q1 oxidoreductase activity in sonicated mitochondrial membranes

    • Growth capacity tests in galactose versus glucose media to assess oxidative phosphorylation function

  • Protein analysis approaches:

    • Analysis of mitochondrial protein synthesis patterns through radioactive labeling

    • Immunoprecipitation experiments to study protein-protein interactions

    • Blue native gel electrophoresis to assess Complex I assembly

These methodologies together provide a comprehensive assessment of MT-ND6's role in mitochondrial function and cellular physiology, allowing researchers to examine both structural and functional aspects of this protein.

How can MT-ND6 serve as a biomarker in sepsis diagnosis and prognosis?

Recent research has identified MT-ND6 as a promising biomarker with significant diagnostic and prognostic value in sepsis:

ParameterMT-ND6 PerformanceComparison to Standard Markers
Diagnostic AUC for sepsis0.789Second only to SOFA scores (AUC = 0.870)
Prognostic cut-off value>1.41 ng/ml associated with higher mortality-
Predictive value for mortality0.705Superior to many conventional markers
Validation cohort diagnostic AUC0.834Confirms robust performance
Validation cohort prognostic AUC0.694Consistent performance across cohorts

The diagnostic performance of MT-ND6 has been demonstrated through:

  • Significantly elevated serum concentrations in patients with sepsis compared to non-septic ICU patients and healthy controls

  • Correlation with disease severity (higher in septic shock and in patients with higher SOFA scores)

  • Association with mortality (higher levels in non-survivors compared to survivors)

Additionally, when combined with other biomarkers like ANXA1, MT-ND6 shows improved predictive values for mortality, particularly in septic patients with mixed hyperinflammation or immunosuppression phenotypes . This suggests potential utility in personalized medicine approaches where biomarker profiles could guide treatment decisions.

What is the relationship between MT-ND6 and immune system function?

MT-ND6 demonstrates important interactions with the immune system, particularly in the context of sepsis and inflammation:

  • MT-ND6 as a mitochondrial DAMP (damage-associated molecular pattern):

    • When released from damaged mitochondria, MT-ND6 can activate the host innate immune response against pathogens

    • Acts as a signal of cellular damage that triggers inflammatory pathways

  • Differential expression across immune phenotypes:

    • Significantly elevated in sepsis patients with immunosuppression phenotypes

    • Higher levels observed in patients with mixed inflammatory phenotypes

    • Lower expression in patients with hyperinflammation only phenotype

  • Potential role in immunomodulation:

    • May contribute to immunosuppression through receptor desensitization mechanisms

    • The binding of mitochondrial formylated peptides to formyl peptide receptor 1 (FPR1) on polymorphonuclear neutrophils can reduce chemotaxis through receptor internalization

    • Elevated levels may contribute to subsequent infections and increased mortality in septic shock patients who survive initial inflammatory phases

This complex relationship with immune function makes MT-ND6 not only a valuable biomarker but potentially an important mechanistic player in sepsis pathophysiology, suggesting possible therapeutic targets in immune-mediated diseases.

What are the optimal storage and handling protocols for recombinant MT-ND6?

To maintain optimal protein stability and activity, researchers should follow these evidence-based protocols for recombinant MT-ND6:

Storage ConditionRecommended ProtocolMaximum Storage Time
Long-term storage (liquid form)-20°C/-80°C6 months
Long-term storage (lyophilized form)-20°C/-80°C12 months
Working aliquots4°CUp to one week

Reconstitution protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage (manufacturer's default is 50%)

  • Prepare working aliquots to minimize freeze-thaw cycles

Critical handling considerations:

  • Avoid repeated freezing and thawing as this significantly compromises protein stability and activity

  • Buffer components, storage temperature, and the intrinsic stability of the protein itself all influence shelf life

  • For experimental use, consistency in handling procedures is essential for reproducible results

These protocols are specifically designed to maintain the structural integrity and functional activity of recombinant MT-ND6 for experimental applications.

How should researchers design experiments to investigate the relationship between MT-ND6 mutations and Complex I dysfunction?

Designing rigorous experiments to study MT-ND6 mutation effects requires careful consideration of several methodological aspects:

  • Model system selection:

    • Cell line models with defined nuclear background (e.g., ρ0 cell lines as recipients for mitochondrial transfer)

    • Use of multiple recipient cell lines to ensure reproducibility of findings

    • Patient-derived cells for studies of clinically relevant mutations

  • Mutation characterization strategy:

    • Complete sequencing of all mtDNA-encoded Complex I subunits to ensure no other mutations are present

    • Quantification of heteroplasmy level (percentage of mutant mtDNA)

    • Analysis of multiple independent clones to control for clonal effects

  • Functional assessment framework:

    • Comprehensive respiratory analysis using multiple substrate combinations

    • Enzymatic activity measurements under varying conditions (temperature, pH)

    • Growth phenotype characterization in different media compositions

    • Assembly analysis through multiple complementary techniques

  • Controls and validation approaches:

    • Generation of revertant cell lines where possible

    • Rescue experiments (e.g., expression of wild-type protein)

    • Comparison with known pathogenic mutations

    • Correlation of mutation load with phenotype severity

This experimental design framework allows for robust assessment of causality between specific MT-ND6 mutations and observed Complex I dysfunction, controlling for potential confounding factors and enabling mechanistic insights.

What techniques can be used to accurately measure MT-ND6 levels in clinical samples for biomarker studies?

For clinical biomarker applications, accurate and reliable measurement of MT-ND6 levels is critical. The following methodological approaches have been validated:

  • Enzyme-linked immunosorbent assay (ELISA):

    • Primary method used in clinical studies for MT-ND6 quantification in serum samples

    • Provides quantitative measurements with good sensitivity and specificity

    • Allows for high-throughput screening of multiple samples

    • Cut-off value of >1.41 ng/ml has been established for mortality prediction in sepsis

  • Sample processing considerations:

    • Standardized collection protocols to minimize pre-analytical variability

    • Careful sample storage (-80°C recommended for long-term storage)

    • Consistent freeze-thaw procedures

    • Use of appropriate controls and standards

  • Statistical analysis approaches:

    • Receiver operating characteristic (ROC) curve analysis to determine diagnostic and prognostic value

    • Kaplan-Meier survival analysis to correlate MT-ND6 levels with clinical outcomes

    • Multivariate analysis to account for confounding factors

    • Assessment of MT-ND6 performance in different patient subgroups based on immune phenotypes

  • Complementary biomarker strategies:

    • Combination with other markers (e.g., ANXA1) to improve predictive performance

    • Integration with clinical severity scores (e.g., SOFA)

    • Longitudinal measurements to track changes over disease course

These methodological approaches provide a framework for reliable MT-ND6 measurement in clinical samples, essential for validating its utility as a biomarker and transitioning to potential clinical applications.

How should researchers interpret contradictory results in MT-ND6 mutation studies?

When faced with contradictory findings in MT-ND6 research, consider these methodological factors that may explain discrepancies:

  • Heteroplasmy level variations:

    • The percentage of mutant mtDNA can vary between studies and significantly impact phenotype severity

    • Threshold effects often exist where dysfunction only becomes apparent above certain heteroplasmy levels

    • Methods for heteroplasmy detection and quantification differ in sensitivity and accuracy

  • Nuclear genetic background differences:

    • The same mtDNA mutation may produce different phenotypes in different nuclear backgrounds

    • Mitochondrial-nuclear interactions can modify the expression of MT-ND6 mutation effects

    • Control for this factor through transmitochondrial cybrid approaches

  • Methodological variations in functional assessment:

    • Different respiratory substrates can reveal or mask Complex I defects

    • Enzyme activity assay conditions (detergents, substrates, temperature) affect results

    • Growth tests may be performed under different media conditions or cell densities

  • Protein product considerations:

    • Some mutations may affect stability rather than intrinsic activity

    • Truncated proteins may have residual function or dominant-negative effects

    • Post-translational modifications can differ between experimental systems

For example, in MT-ND6 frameshift mutation studies, the observed phenotypes in mouse cells include severe respiration defects and complete growth failure in galactose media, but the same mutation might show variable severity in different cell types or species .

What factors should be considered when evaluating MT-ND6 as a biomarker in different patient populations?

When evaluating MT-ND6 as a biomarker across different patient populations, several critical factors must be considered:

FactorConsiderationImpact on Interpretation
Patient immune phenotypeClassify based on pro-inflammatory and anti-inflammatory cytokine profilesMT-ND6 shows different associations with mortality in different immune phenotypes
Disease severityStratify by SOFA scores or presence of septic shockHigher MT-ND6 levels correlate with higher SOFA scores and septic shock
Timing of measurementStandardize collection relative to disease onsetLevels may change throughout disease progression
Co-morbiditiesAccount for conditions affecting mitochondrial functionMay influence baseline MT-ND6 levels
Demographic factorsConsider age, sex, and ethnic backgroundMay affect reference ranges
Treatment statusDocument interventions prior to samplingTreatments may alter MT-ND6 release or clearance

Research has demonstrated that MT-ND6 levels are significantly elevated in sepsis patients with immunosuppression and mixed inflammation phenotypes, but not in those with hyperinflammation only . This suggests that patient stratification based on immune status is essential for proper interpretation of MT-ND6 as a biomarker.

Additionally, the combination of MT-ND6 with other markers like ANXA1 improves predictive performance, particularly in patients with mixed inflammatory phenotypes . This highlights the importance of considering biomarker panels rather than individual markers in heterogeneous conditions like sepsis.

What are the major technical challenges in studying MT-ND6 and how can they be overcome?

Researchers face several technical challenges when studying MT-ND6 that require specific methodological solutions:

  • Protein stability and solubility issues:

    • Challenge: As a hydrophobic membrane protein, MT-ND6 can be difficult to maintain in a stable, soluble form outside its native environment

    • Solution: Use optimal buffer conditions with appropriate detergents; add glycerol (5-50%) for stability; maintain strict temperature control during handling

  • Detection of truncated or mutated products:

    • Challenge: Frameshift mutations often result in unstable products that are difficult to detect in conventional assays

    • Solution: Use sensitive techniques like pulse-chase labeling combined with immunoprecipitation; focus on functional assays rather than direct protein detection

  • Assembly analysis complexity:

    • Challenge: Distinguishing between direct effects of MT-ND6 absence and secondary effects on Complex I assembly

    • Solution: Combine multiple approaches including blue native gel electrophoresis, immunoprecipitation with antibodies against different Complex I subunits, and pulse-chase experiments to track assembly intermediates

  • Heteroplasmy quantification accuracy:

    • Challenge: Accurately determining the percentage of mutant mtDNA, especially at low levels

    • Solution: Use sensitive techniques like digital PCR, next-generation sequencing, or allele-specific primer extension; validate with multiple methods

  • Translation of in vitro findings to in vivo relevance:

    • Challenge: Determining whether cell culture findings reflect physiological conditions

    • Solution: Validate in multiple cell types; correlate with patient data where available; consider developing animal models for systemic effects

These methodological solutions enable more robust and reproducible MT-ND6 research despite the inherent technical challenges associated with this mitochondrial membrane protein.

How can researchers integrate MT-ND6 findings with broader mitochondrial and cellular metabolism studies?

To place MT-ND6 research in a broader metabolic context, researchers should consider these integration strategies:

For example, studies have shown that cells with MT-ND6 deficiency completely fail to grow in galactose-containing media, indicating their inability to rely on oxidative phosphorylation and forced dependence on glycolysis . This finding can be integrated with broader metabolic studies by examining compensatory pathways, metabolite accumulation, and energy sensing mechanisms like AMPK activation.

What are the most promising future directions for MT-ND6 research?

Based on current scientific evidence, several promising research directions for MT-ND6 are emerging:

  • Advanced structural biology approaches:

    • High-resolution cryo-electron microscopy to determine MT-ND6 positioning and interactions within Complex I

    • Investigation of conformational changes during electron transfer and proton pumping

    • Structure-based design of tools to modulate MT-ND6 function

  • Development as a clinical biomarker:

    • Large-scale validation studies across diverse patient populations

    • Standardization of measurement protocols for clinical application

    • Integration into multimarker panels for improved diagnostic and prognostic accuracy

  • Therapeutic target exploration:

    • Identification of compounds that can modulate MT-ND6 release or activity

    • Development of strategies to enhance Complex I assembly in MT-ND6 deficiency

    • Targeted approaches for conditions where MT-ND6 contributes to pathology, such as sepsis-induced immunosuppression

  • Expanded role in immune regulation:

    • Further characterization of MT-ND6 as a mitochondrial damage-associated molecular pattern

    • Investigation of receptor interactions and downstream signaling pathways

    • Examination of MT-ND6's role in various inflammatory and immune-mediated conditions

These research directions hold significant potential for advancing our understanding of MT-ND6 biology and translating that knowledge into clinical applications for diagnosis, prognosis, and potentially therapeutic interventions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.