Recombinant Lawsonia intracellularis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC and Its Role in Bacterial Membrane Protein Biogenesis

YidC is a universally conserved membrane protein insertase critical for the biogenesis of α-helical membrane proteins across bacteria, mitochondria, and chloroplasts. In bacteria, YidC facilitates the co-translational insertion of membrane proteins either independently or in concert with the Sec translocon . While YidC has been extensively studied in model organisms like Escherichia coli and Bacillus halodurans, its homolog in Lawsonia intracellularis—an obligate intracellular pathogen causing proliferative enteropathy in pigs—remains underexplored. Recombinant YidC refers to the protein produced via heterologous expression systems for functional and structural studies.

Recombinant YidC Production in Model Organisms

While no studies directly address recombinant Lawsonia intracellularis YidC, insights can be extrapolated from homologous systems:

OrganismExpression SystemKey FindingsReference
E. coliProteoliposomesPurified YidC inserts Pf3 coat protein at ~150 substrates per YidC molecule .
B. haloduransIn vitro reconstitutionCrystal structure reveals a hydrophilic groove critical for substrate binding .
Streptococcus mutansMutagenesis studiesCytoplasmic loops (C1, C2) mediate substrate interaction and acid stress response .

Potential Implications for Lawsonia intracellularis Pathogenesis

Lawsonia intracellularis relies on host cell machinery for survival, but its YidC homolog may play roles in:

  • Membrane Protein Biogenesis: Insertion of virulence factors or secretion systems (e.g., T3SS) .

  • Host-Pathogen Interactions: Modulating host cell lipid organization or immune evasion .

Critical Knowledge Gaps:

  • No direct studies on Lawsonia intracellularis YidC exist.

  • Structural and functional data are inferred from homologs like E. coli YidC .

Challenges in Studying Lawsonia intracellularis YidC

  1. Cultivation Difficulties: L. intracellularis is an obligate intracellular pathogen, complicating recombinant protein production .

  2. Genetic Intractability: Limited tools for gene deletion/complementation hinder functional studies .

  3. Host-Specific Adaptations: YidC may exhibit unique features tailored to L. intracellularis’ intracellular niche .

Future Research Directions

  1. Heterologous Expression: Express L. intracellularis YidC in E. coli or yeast for biochemical characterization.

  2. Cryo-EM Studies: Resolve structural details of YidC-substrate complexes.

  3. Mutational Analysis: Identify residues critical for insertase activity using alanine-scanning .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; LI1070; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Lawsonia intracellularis (strain PHE/MN1-00)
Target Names
yidC
Target Protein Sequence
MEDKRIVLAIILSLVVFLGWHSFAEYMGWISPKVQHVANERHSSVDQTATSNIALDSVQS VFSPPTGKDVYIETPLYIAKIHSSGGILSSFILKKYKVNLDNTSPLVNLVSPEASQAMPL GITLNGQPSWSNGNWSFLGGDLYLKPGETKELTFVGIVNGVKIIRIFTFNADSYLIHEKL QLASEKQNSCPTKVGLLVAATPFGTGQYDPTRMAWSIKDSFKEETSIDTLKEKGIQESGE FNWGGVMSNYFMNVVALSDPLYLTIKGRIQNDVWRVALERSNVLIPAEGTTSITVNWWFG PKDRELLSRAPDKLENAIDFGMFSIIAKPLLTALTFFYEYTGNWGVAIIVLTLCIKIVFW PLSQKSYNSMEQMKKLQPMMQKLREKYANDRDTLNREIMQLYKTYKVNPAGGCLPILLQI PVFIGLYQALLNSIELRHATFIYYLPFTHLVWLADLSAADPFYITPLLMGASMFLQQKLT PASGDPTQQKIMMVMPIIFTVMFLNFPAGLVIYWLFNNLLSIGQQWWMLRKA
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links

KEGG: lip:LI1070

STRING: 363253.LI1070

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of YidC in Lawsonia intracellularis?

YidC in Lawsonia intracellularis is a 532 amino acid membrane protein with a molecular mass of approximately 60 kDa . It belongs to the OXA1/ALB3/YidC family, Type 1 subfamily, and functions as a membrane protein insertase . The primary role of YidC is to facilitate the insertion, proper folding, and complex formation of integral membrane proteins into the bacterial membrane . It's particularly involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, and aids in the folding of multispanning membrane proteins .

The structure features multiple transmembrane domains that form a helical bundle, creating an environment that allows hydrophobic segments of substrate proteins to transition from the aqueous cellular environment into the lipid bilayer . Unlike the Sec translocase, which operates as a transmembrane channel that can open laterally, YidC interacts with its substrates in a groove-like structure at an amphiphilic protein-lipid interface .

How does the amino acid sequence of Lawsonia intracellularis YidC compare with YidC from other bacterial species?

The amino acid sequence of Lawsonia intracellularis YidC (532 aa) differs from other bacterial species while maintaining conserved functional domains. For comparison, Vibrio cholerae YidC consists of 541 amino acids and shares similar functional domains despite sequence variations .

Sequence comparison table:

SpeciesLengthConserved FeaturesNotable Differences
Lawsonia intracellularis532 aaCore transmembrane domains, OXA1/ALB3/YidC family motifsUnique N-terminal sequence
Vibrio cholerae541 aaCore transmembrane domains, OXA1/ALB3/YidC family motifsExtended N-terminal region, variation in cytoplasmic loops
E. coli (reference)~548 aaCore transmembrane domains, OXA1/ALB3/YidC family motifsDifferent periplasmic domain organization

The sequence conservation is strongest in the transmembrane regions and the substrate-binding groove, highlighting the functional importance of these domains across bacterial species .

What experimental approaches can be used to verify the expression of recombinant Lawsonia intracellularis YidC?

Verification of recombinant Lawsonia intracellularis YidC expression can be achieved through multiple complementary approaches:

  • SDS-PAGE analysis: Purified recombinant protein should show a band at approximately 60 kDa, with purity greater than 90% for reliable experimental use .

  • Western blotting: Using anti-His antibodies for His-tagged constructs or specific anti-YidC antibodies for untagged proteins.

  • Mass spectrometry: For precise molecular weight determination and peptide fingerprinting to confirm identity.

  • Functional complementation assays: Testing whether the recombinant protein can rescue YidC-deficient bacterial strains, similar to the approach used in the validation of E. coli YidC models where alanine mutants were subjected to in vivo complementation assays .

  • Microscopy techniques: For tagged constructs, fluorescence microscopy can confirm membrane localization.

For optimal results, researchers should store the lyophilized protein at -20°C/-80°C upon receipt, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and add 5-50% glycerol for long-term storage .

How does the mechanism of YidC-mediated membrane protein insertion differ from Sec translocase-dependent insertion?

YidC and Sec translocase employ fundamentally different mechanisms for membrane protein insertion:

Sec translocase-dependent insertion:

  • Functions as a transmembrane channel that can open laterally

  • First binds hydrophobic segments within the channel, then releases them into the lipid bilayer

  • Often requires additional energy input through ATP hydrolysis for translocation

  • Typically handles more complex substrates with large periplasmic domains

Interestingly, YidC can function both independently and in conjunction with the Sec translocase, indicating a complex interplay between these two systems in membrane protein biogenesis . Structural models from evolutionary co-variation analysis and cryo-EM studies have revealed that YidC interacts with ribosome nascent chains, positioning itself to receive the emerging transmembrane segments directly from the ribosomal exit tunnel .

How do molecular dynamics simulations contribute to understanding YidC structure-function relationships?

Molecular dynamics (MD) simulations provide crucial insights into YidC's dynamic behavior within the membrane environment, revealing structure-function relationships that static structural models cannot capture :

  • Membrane integration stability: MD simulations have demonstrated the stability of YidC's transmembrane helices within the lipid bilayer, with analysis of inter-residue interactions revealing how hydrophobic residues on the exterior stabilize interactions with lipid tails while the core is stabilized through helix-helix interactions .

  • Residue importance verification: MD simulations identified key stabilizing residues, such as T362 in TM2 and Y517 in TM6, which when mutated to alanine completely inactivated YidC in subsequent in vivo complementation assays . This approach provides a powerful method to predict functionally critical residues before experimental validation.

  • Dynamic substrate binding groove: Simulations reveal the flexibility of YidC's substrate-binding regions, showing how the protein can accommodate diverse substrate transmembrane segments .

  • Lipid-protein interactions: MD analysis demonstrates how YidC thins the surrounding membrane and creates a unique local environment that facilitates protein insertion, with detailed characterization of hydrogen bonding patterns and electrostatic interactions at the protein-lipid interface .

For researchers studying L. intracellularis YidC, applying similar MD approaches would provide valuable insights into its specific structural adaptations and substrate preferences compared to better-studied bacterial homologs.

What are the optimal conditions for expressing and purifying recombinant Lawsonia intracellularis YidC?

Optimal expression and purification of recombinant L. intracellularis YidC requires careful consideration of several parameters:

Expression system selection:

  • E. coli is the preferred heterologous expression system for L. intracellularis YidC

  • BL21(DE3) or C41(DE3) strains are recommended for membrane protein expression

  • Expression vectors containing T7 promoters with His-tag fusion for purification facilitate downstream processing

Expression conditions:

  • Induction at lower temperatures (16-20°C) often improves proper folding

  • IPTG concentration of 0.1-0.5 mM typically provides optimal induction

  • Extended expression times (16-24 hours) at lower temperatures maximize yield

Purification protocol:

  • Cell lysis using detergent mixtures (typically containing n-dodecyl-β-D-maltoside)

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization of membrane proteins with appropriate detergents

  • Affinity chromatography using Ni-NTA resin for His-tagged constructs

  • Size exclusion chromatography for further purification

  • Quality assessment via SDS-PAGE (>90% purity standard)

Storage recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Reconstitute in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Reconstituted protein remains stable at 4°C for approximately one week

How can researchers effectively design functional assays to study YidC activity?

Designing effective functional assays for YidC activity involves multiple approaches targeting different aspects of its membrane insertion function:

In vivo complementation assays:

  • Generate YidC-depleted or temperature-sensitive YidC mutant bacterial strains

  • Transform with plasmids expressing L. intracellularis YidC or variant constructs

  • Assess growth restoration under non-permissive conditions

  • Quantify complementation efficiency through growth curves or colony-forming units

Substrate insertion assays:

  • Select well-characterized YidC substrates (e.g., F₁F₀ ATP synthase subunit c, Pf3 coat protein)

  • Express these substrates in cells with depleted endogenous YidC and recombinant L. intracellularis YidC

  • Assess membrane integration through protease protection assays or membrane fractionation

  • Quantify insertion efficiency through western blotting or radiolabeling approaches

In vitro reconstitution:

  • Purify recombinant L. intracellularis YidC and reconstitute into liposomes

  • Add in vitro translated substrate proteins

  • Assess insertion through flotation assays or protease protection

  • Use fluorescence resonance energy transfer (FRET) to measure direct interactions

Ribosome binding assays:

  • Purify ribosomes translating YidC substrates

  • Add recombinant L. intracellularis YidC

  • Assess binding through co-sedimentation or microscale thermophoresis

  • Visualize interactions using cryo-electron microscopy as demonstrated with E. coli YidC

What structural biology techniques are most effective for characterizing YidC structure?

Multiple structural biology techniques provide complementary insights into YidC structure:

X-ray crystallography:

  • Advantages: Atomic-level resolution revealing precise side-chain positions

  • Challenges: Membrane protein crystallization is difficult, often requiring extensive construct optimization

  • Applications: Has been successfully applied to bacterial YidC homologs, providing high-resolution structural details

Cryo-electron microscopy (cryo-EM):

  • Advantages: Can visualize YidC in functional complexes (e.g., with ribosomes) and doesn't require crystallization

  • Resolution: Modern techniques achieve near-atomic resolution (~3-4Å)

  • Applications: Successfully used to visualize YidC-ribosome complexes, revealing how nascent chains interact with the insertase

Nuclear magnetic resonance (NMR) spectroscopy:

  • Advantages: Provides dynamic information in solution state

  • Limitations: Size constraints make full-length studies challenging

  • Applications: Useful for studying specific domains or transmembrane segments

Evolutionary coupling analysis:

  • Method: Uses statistical analysis of sequence co-variation to predict residue proximity

  • Advantages: Computationally accessible, requires only sequence data

  • Applications: Successfully used to generate initial structural models of E. coli YidC that aligned well with experimental structures

Molecular dynamics simulations:

  • Purpose: Reveals dynamic behavior and stability in membrane environment

  • Applications: Identifies key stabilizing interactions and flexible regions

  • Integration: Combines with experimental structures to provide complete functional picture

For comprehensive structural characterization of L. intracellularis YidC, researchers should ideally combine high-resolution techniques (X-ray crystallography or cryo-EM) with dynamics studies (MD simulations) and functional validation through mutagenesis .

How should researchers interpret discrepancies between in silico predictions and experimental results for YidC structure and function?

When facing discrepancies between in silico predictions and experimental results for YidC, researchers should follow this systematic approach:

Analyze prediction limitations:

  • Examine the input data quality for computational models (sequence alignment depth, homology template selection)

  • Consider the force fields used in simulations and their known limitations for membrane proteins

  • Evaluate whether the modeling included the membrane environment appropriately

Scrutinize experimental conditions:

  • Assess whether detergents or lipid compositions used experimentally match the native environment

  • Consider whether tags or fusion partners might affect protein behavior

  • Evaluate protein stability and proper folding in the experimental system

Systematic validation approach:

  • Perform site-directed mutagenesis targeting discrepant regions

  • Employ complementary structural techniques (e.g., if cryo-EM and modeling disagree, try cross-linking experiments)

  • Use evolutionary analysis to determine if discrepant residues are conserved, suggesting functional importance

Case example - E. coli YidC:
The initial structural model based on evolutionary co-variation analysis predicted specific helix-helix contacts in E. coli YidC. These were then validated through molecular dynamics simulations identifying key stabilizing residues (T362, Y517). When these were mutated to alanine, they completely inactivated YidC in vivo, confirming the model's accuracy despite initial uncertainty . This demonstrates how computational predictions, even when initially questionable, can be systematically validated through targeted experimental approaches.

What bioinformatic approaches can identify potential YidC substrates in Lawsonia intracellularis?

Identifying potential YidC substrates in L. intracellularis requires multi-faceted bioinformatic approaches:

Transmembrane topology prediction:

  • Analyze the L. intracellularis proteome using algorithms like TMHMM, Phobius, or TOPCONS

  • Focus on proteins with 1-3 transmembrane domains, typical of YidC-dependent substrates

  • Evaluate hydrophobicity profiles and charge distribution of transmembrane segments

Homology-based substrate identification:

  • Compile known YidC substrates from model organisms (E. coli, B. subtilis)

  • Perform BLAST or HMM-based searches against the L. intracellularis genome

  • Prioritize hits with conserved sequence features in transmembrane regions

Machine learning classification:

  • Train models on known YidC vs. Sec-dependent substrates using sequence features

  • Apply trained models to predict L. intracellularis membrane proteome sorting

  • Validate predictions through experimental approaches

Genome context analysis:

  • Examine genomic neighborhoods of yidC in L. intracellularis

  • Identify co-transcribed genes potentially encoding substrates

  • Look for conservation of these patterns across related bacterial species

Structural compatibility assessment:

  • Model transmembrane segments of candidate substrates

  • Evaluate compatibility with the YidC hydrophilic groove dimensions

  • Assess charge complementarity between YidC and potential substrates

Particularly promising candidates would include small membrane proteins involved in energy metabolism, similar to known YidC substrates such as F₀c and CyoA in other bacteria, which could be prioritized for experimental validation .

How can researchers interpret YidC structural data in the context of membrane protein insertion mechanisms?

Interpreting YidC structural data requires connecting structural features to the functional mechanism of membrane protein insertion:

Key structural elements to analyze:

  • Hydrophilic groove: The presence and dimensions of the substrate-binding groove determine which proteins can be inserted

  • Membrane-thinning effects: YidC creates local membrane perturbations that lower the energetic barrier for insertion

  • Ribosome binding interface: The cytoplasmic regions that interact with ribosomes coordinate co-translational insertion

  • Lipid-facing surfaces: The hydrophobic exterior surfaces that mediate YidC integration into the membrane

Functional interpretation framework:

  • Substrate pathway mapping: Trace the potential path of inserting proteins from ribosome exit through YidC and into the membrane

  • Energetic analysis: Identify residues that could stabilize transmembrane segments during the transition from aqueous to lipid environments

  • Conformational changes: Analyze flexible regions that might accommodate different substrate sizes or facilitate insertion steps

Integration with experimental data:
The E. coli YidC model from evolutionary covariation analysis revealed a pentagon-like arrangement of transmembrane helices (in the order 4-5-3-2-6 when viewed from the cytoplasm) with a hydrophilic groove at the protein-lipid interface . This structure explained how YidC creates an environment favorable for membrane protein insertion without forming a complete channel like the Sec translocase .

Cryo-EM studies further showed how YidC positions itself to receive nascent chains directly from the ribosomal exit tunnel, with the transmembrane helix of the substrate aligning with the hydrophilic groove of YidC . This structural arrangement supports a model where YidC provides a protected environment for inserting transmembrane segments while allowing lateral movement into the lipid bilayer .

How might YidC function be targeted for antimicrobial development against Lawsonia intracellularis?

YidC represents a promising antimicrobial target against L. intracellularis for several reasons:

Target validation rationale:

  • YidC is essential for viability in most bacteria studied

  • It has no direct human homolog with the same function

  • It's membrane-accessible, potentially allowing drug entry without cell penetration

  • L. intracellularis, as an obligate intracellular pathogen, likely depends heavily on proper membrane protein insertion for survival and virulence

Potential inhibition strategies:

  • Small molecule inhibitors: Design compounds that bind the hydrophilic groove, preventing substrate interaction

  • Peptide mimetics: Develop peptides that mimic YidC substrates but block the insertion pathway

  • Allosteric modulators: Target regions that affect conformational changes necessary for function

  • Ribosome-binding interference: Develop compounds that disrupt YidC-ribosome interactions essential for co-translational insertion

Structure-based drug design approach:

  • Use structural models and experimental validation to identify critical residues unique to L. intracellularis YidC

  • Focus on regions with low conservation to human membrane protein insertion machinery

  • Perform virtual screening against the identified pockets

  • Validate hits through in vitro insertion assays and bacterial growth inhibition

Combination therapy potential:
L. intracellularis possesses a type III secretion system (T3SS) that contributes to pathogenesis . Since proper assembly of many T3SS components likely requires YidC, combining YidC inhibitors with drugs targeting other aspects of the T3SS might provide synergistic antimicrobial effects while reducing the potential for resistance development.

What are the key considerations for using recombinant YidC in membrane protein production systems?

Leveraging recombinant YidC for enhanced membrane protein production requires strategic implementation:

System design considerations:

  • Expression level optimization: Titrate YidC expression to avoid toxicity while ensuring sufficient levels for substrate processing

  • Compatibility with host machinery: Ensure L. intracellularis YidC can interface with the host's ribosomes and membrane insertion components

  • Substrate specificity: Determine if L. intracellularis YidC has different substrate preferences than the host's native insertase

Implementation strategies:

  • Co-expression systems: Design vectors that co-express YidC alongside the target membrane protein

  • Inducible regulation: Use orthogonal induction systems to control both YidC and target protein expression

  • Membrane engineering: Optimize lipid composition to support both YidC function and target protein stability

  • Fusion approaches: Create chimeric YidC proteins combining domains from different species to optimize function in heterologous systems

Experimental validation metrics:

  • Yield comparison: Quantify target protein yields with and without YidC co-expression

  • Functional assays: Assess whether increased yields correlate with properly folded, functional protein

  • Membrane integration: Verify proper membrane insertion through protease protection or fractionation studies

  • Structural integrity: Use biophysical methods to confirm structural integrity of the produced membrane proteins

The successful implementation of recombinant YidC in production systems would be particularly valuable for structural biology applications requiring large quantities of correctly folded membrane proteins, potentially enabling structural studies of previously challenging targets .

How can researchers design experiments to study the evolutionary conservation of YidC function across bacterial species?

Designing experiments to investigate YidC evolutionary conservation requires a systematic comparative approach:

Sequence-structure-function analysis pipeline:

  • Perform comprehensive sequence alignment of YidC proteins across diverse bacterial phyla

  • Identify absolutely conserved residues versus clade-specific variations

  • Map conservation patterns onto structural models to identify functional hotspots

  • Design targeted mutations to test the importance of conserved versus variable regions

Cross-species complementation experimental design:

  • Generate conditional YidC depletion strains in model organisms (E. coli, B. subtilis)

  • Transform with plasmids expressing YidC from diverse species, including L. intracellularis

  • Quantify growth restoration under depletion conditions

  • Correlate complementation efficiency with sequence divergence metrics

Comparative substrate profiling:

  • Identify known YidC substrates from model organisms

  • Test their insertion by YidC homologs from different species

  • Determine if substrate specificity correlates with bacterial lifestyle (e.g., pathogens vs. free-living)

  • Use chimeric YidC proteins to map regions responsible for substrate preferences

Evolutionary rate analysis:

  • Calculate evolutionary rates for different YidC domains

  • Test correlation between evolutionary rate and functional importance

  • Identify potential co-evolution between YidC and its substrates

  • Investigate adaptive evolution signatures in specific bacterial lineages

This research would provide insights into how YidC function has been maintained across diverse bacterial species while potentially adapting to specific membrane compositions or substrate requirements. Understanding this evolutionary plasticity could inform both fundamental membrane biology and targeted antimicrobial development .

What are the most promising future research directions for understanding Lawsonia intracellularis YidC function?

Several promising research directions would advance understanding of L. intracellularis YidC:

Structural biology priorities:

  • Determine high-resolution structure of L. intracellularis YidC through cryo-EM or X-ray crystallography

  • Capture conformational states during the insertion process using advanced techniques like time-resolved cryo-EM

  • Visualize YidC-ribosome nascent chain complexes to understand co-translational insertion mechanisms

Substrate identification and characterization:

  • Develop proteomics approaches to identify the complete set of L. intracellularis YidC substrates

  • Characterize the features distinguishing YidC-dependent from Sec-dependent substrates in this organism

  • Investigate whether L. intracellularis YidC has unique substrate preferences compared to other bacterial species

Pathogenesis relevance:

  • Determine if YidC is essential for L. intracellularis virulence through conditional knockdown studies

  • Identify virulence factors dependent on YidC for proper membrane insertion

  • Investigate YidC's role in assembling the type III secretion system critical for pathogenesis

Therapeutic targeting:

  • Develop high-throughput screening assays for YidC inhibitors

  • Design peptidomimetics that compete with natural substrates for YidC binding

  • Explore whether YidC inhibition synergizes with existing antibiotics

Cross-system comparisons:

  • Compare L. intracellularis YidC function with homologs from related pathogens

  • Investigate co-evolution between YidC and substrates within this bacterial lineage

  • Examine adaptive changes in YidC that might reflect the organism's obligate intracellular lifestyle

These research directions would not only advance fundamental understanding of membrane protein biogenesis but could potentially lead to novel therapeutic approaches against this economically significant pathogen.

What methodological advances would most significantly improve research on membrane insertases like YidC?

Several methodological advances would transform research on membrane insertases:

Technical innovations needed:

  • In situ structural determination: Methods to visualize YidC structure and substrate interactions within native membranes at high resolution

  • Single-molecule insertion tracking: Techniques to observe individual insertion events in real-time

  • Quantitative insertion assays: Standardized approaches to measure insertion efficiency with greater precision

  • Membrane mimetics: Improved systems that better replicate the native membrane environment

Computational method development:

  • Machine learning substrate prediction: Advanced algorithms to predict YidC-dependent substrates with higher accuracy

  • Molecular dynamics improvements: Enhanced force fields specifically optimized for membrane protein-lipid interactions

  • Insertion energetics modeling: Computational methods to predict the energetic landscape of membrane protein insertion

Genetic tool advancement:

  • Conditional expression systems for L. intracellularis: Given its obligate intracellular nature, better genetic tools are needed

  • High-throughput mutagenesis: Methods for systematic functional screening of YidC variants

  • In vivo labeling techniques: Approaches to track YidC-substrate interactions in living cells

Integration approaches:

  • Multi-scale modeling: Connecting atomic-level simulations with cellular-scale effects

  • Systems biology integration: Linking YidC function to broader cellular processes and stress responses

  • Evolutionary analysis tools: Methods to better understand YidC adaptation across bacterial lineages

These methodological advances would collectively enable researchers to address fundamental questions about membrane protein insertion mechanisms that remain challenging with current techniques, potentially leading to breakthroughs in both basic understanding and applied aspects of YidC biology .

How might understanding YidC function contribute to broader knowledge in bacterial physiology and pathogenesis?

Understanding YidC function has far-reaching implications:

Fundamental cellular processes:

  • Membrane biogenesis: YidC studies reveal core principles of how cells build and maintain their membrane proteome

  • Protein folding mechanisms: Insights into how hydrophobic proteins achieve correct folding in lipid environments

  • Energy metabolism: Many YidC substrates are components of energy-generating systems, linking insertion to bioenergetics

Bacterial adaptation mechanisms:

  • Environmental stress responses: YidC likely plays crucial roles in membrane remodeling during stress

  • Host-pathogen interactions: Proper insertion of virulence factors depends on YidC function

  • Antibiotic resistance: Some resistance mechanisms involve membrane protein changes requiring YidC

Evolutionary perspectives:

  • Organelle evolution: YidC homologs exist in mitochondria and chloroplasts, connecting to endosymbiosis history

  • Membrane complexity development: Comparing YidC across species reveals how membrane proteome complexity evolved

  • Specialization patterns: Differences in YidC across bacterial lineages reflect adaptation to specific niches

Translational applications:

  • Antimicrobial development: YidC targeting offers a novel approach against bacteria like L. intracellularis

  • Biotechnology applications: Engineered YidC systems could enhance membrane protein production

  • Synthetic biology platforms: YidC could be incorporated into minimal cells or membrane-based nanobiotechnology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.