Recombinant Leggadina forresti Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the available format, please specify your requirements during order placement for preferential preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please specify your requirements for preferential tag development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Leggadina forresti (Forrest's mouse) (Pseudomys forresti)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNELKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis via transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, comprising heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the typical nucleotide composition of Leggadina forresti MT-CO2?

Based on comparative studies with other rodent species and the analysis techniques used in similar studies, the MT-CO2 gene in Leggadina forresti likely shows a bias toward A+T content. In other mammals such as the giant panda, researchers have documented nucleotide compositions averaging 33.9% for A, 29.5% for T, 15.1% for G, and 21.5% for C, resulting in an A+T content of 63.4% . For L. forresti, researchers should perform specific nucleotide composition analysis using bioinformatic tools such as MEGA or DNAsp after sequencing to determine exact ratios, which can provide insights into codon usage patterns and evolutionary constraints on the gene.

How can I identify conserved domains in Leggadina forresti MT-CO2?

Multiple sequence alignment techniques should be employed to compare the L. forresti MT-CO2 sequence with homologs from other species. Software such as Clustal Omega, MUSCLE, or T-Coffee can effectively align sequences, after which conserved regions can be visualized using programs like Jalview or WebLogo. Focus analysis on the metal-binding sites and substrate interaction regions, which are typically highly conserved across species. After alignment, conservation scores for each amino acid position can be calculated to quantitatively assess domain conservation, with particular attention to functional domains involved in electron transport.

What expression system is optimal for recombinant Leggadina forresti MT-CO2?

While bacterial expression systems (particularly E. coli) offer simplicity and high yields, they often struggle with properly folding mitochondrial membrane proteins. For MT-CO2, a eukaryotic expression system such as insect cells (Sf9, Sf21) or yeast (Pichia pastoris) will typically provide better results due to their capacity for post-translational modifications and proper membrane protein folding. For initial screening experiments, the following expression systems can be evaluated:

Expression SystemAdvantagesLimitationsRecommended for MT-CO2
E. coliHigh yield, inexpensive, rapidLimited post-translational modifications, inclusion body formationNot ideal for full-length protein
Pichia pastorisHigh density culture, proper foldingLonger expression timeGood for functional studies
Insect cellsPost-translational modifications, membrane protein expressionHigher cost, technical complexityOptimal for structural studies
Mammalian cellsNative-like folding and modificationsHighest cost, lowest yieldBest for interaction studies

Select the system based on your specific experimental needs—structural studies may require the highest quality protein from insect or mammalian cells, while functional assays might be successful with yeast-expressed protein.

How can I optimize codon usage for Leggadina forresti MT-CO2 expression?

Codon optimization is crucial for heterologous expression of L. forresti MT-CO2. Analyze the native sequence for rare codons that might cause translational pauses in your chosen expression system. Software tools like OPTIMIZER, GeneArt, or IDT Codon Optimization Tool can generate optimized sequences based on the codon usage bias of your expression host. For E. coli expression, consider using Rosetta strains that supply tRNAs for rare codons. When optimizing, preserve critical secondary structure elements that may be important for proper folding, particularly around functional regions identified through sequence analysis.

What is the most effective purification strategy for recombinant MT-CO2?

Purification of membrane proteins like MT-CO2 requires careful handling of detergents. A multi-step purification protocol is recommended:

  • Solubilization: Extract using mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their critical micelle concentration.

  • Initial purification: Utilize affinity chromatography with a fusion tag (His6, FLAG, or Strep-tag) positioned to minimize interference with protein function.

  • Secondary purification: Apply size exclusion chromatography to separate properly folded protein from aggregates and remove detergent micelles.

  • Purity assessment: Confirm using SDS-PAGE, Western blotting, and mass spectrometry. Aim for >95% purity for structural and functional studies.

Maintain protein stability throughout by including glycerol (10-15%) and appropriate cofactors in all buffers, and keep samples cold to prevent degradation.

How can I verify the functional integrity of purified recombinant MT-CO2?

Functional assessment of MT-CO2 requires evaluation of electron transfer capacity. Implement the following approaches:

  • Cytochrome c oxidation assay: Measure the rate of ferrocytochrome c oxidation spectrophotometrically by monitoring absorbance decrease at 550 nm in the presence of your recombinant MT-CO2.

  • Oxygen consumption: Use oxygen electrode systems (Clark-type) to quantify oxygen consumption rates when the recombinant protein is incorporated into liposomes or nanodiscs.

  • Binding studies: Employ isothermal titration calorimetry or microscale thermophoresis to measure interactions with known binding partners.

  • Structural integrity: Use circular dichroism spectroscopy to verify secondary structure composition, comparing results with predicted structures based on homology models.

What approaches can determine the haplotype diversity of Leggadina forresti MT-CO2?

To assess haplotype diversity, sequences from multiple individuals should be analyzed using population genetics software like DnaSP or Arlequin. Calculate key metrics including:

  • Haplotype diversity (Hd): Measure of uniqueness of haplotypes in the population.

  • Nucleotide diversity (π): Average number of nucleotide differences per site between sequences.

  • Tajima's D and Fu's Fs: Tests for detecting population expansions or selection.

For context, studies on the giant panda COX2 gene revealed three haplotypes with a haplotype diversity of 0.567 and nucleotide diversity of 0.0019 . For L. forresti, construct a statistical parsimony network to visualize relationships between haplotypes, which can provide insights into population structure and evolutionary history.

How can recombinant MT-CO2 be used to study mitochondrial adaptation in arid-zone rodents?

Leggadina forresti, as an arid-zone specialist, may exhibit adaptive features in mitochondrial functioning. Use the recombinant MT-CO2 to:

  • Conduct comparative enzyme kinetics studies under varying temperature and pH conditions to assess thermal stability and pH optima relative to mesic-adapted relatives.

  • Perform protein engineering experiments introducing specific mutations found in L. forresti into MT-CO2 of mesic rodents to identify adaptively significant residues.

  • Develop reconstituted systems with other respiratory chain components to measure efficiency of electron transport under conditions mimicking metabolic stress.

  • Compare oxygen affinity and reaction rates with homologs from related species inhabiting different ecological niches to identify potential adaptations to resource-limited environments.

Document all kinetic parameters (Km, Vmax, catalytic efficiency) under standardized conditions to facilitate meaningful cross-species comparisons.

What approaches can investigate the interaction between MT-CO2 and environmental stressors?

To study how environmental factors affect MT-CO2 function:

  • Thermal stability assays: Use differential scanning fluorimetry or circular dichroism with thermal ramping to assess protein stability across temperature gradients.

  • Oxidative stress response: Expose recombinant MT-CO2 to controlled levels of reactive oxygen species and measure functional changes and structural alterations.

  • Dehydration effects: Examine activity under varying osmotic conditions to mimic arid environments.

  • Mutational analysis: Create site-directed mutants of conserved residues to identify those critical for maintaining function under stress conditions.

These approaches provide insights into molecular adaptations that may enable Leggadina forresti to thrive in challenging environments.

How can I resolve inclusion body formation when expressing Leggadina forresti MT-CO2?

Inclusion body formation is common with membrane proteins like MT-CO2. Implement these strategies:

  • Reduce expression temperature to 16-20°C and use weaker promoters to slow protein production.

  • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ) to assist protein folding.

  • Add fusion partners known to enhance solubility (MBP, SUMO, or Thioredoxin) to the N-terminus.

  • For refolding from inclusion bodies:

    • Solubilize using 6-8 M urea or guanidine hydrochloride

    • Remove denaturant gradually through dialysis

    • Include appropriate detergents during refolding

    • Add cofactors such as heme to facilitate proper folding

Optimize each step using small-scale experiments before scaling up production.

What controls are essential for validating recombinant MT-CO2 functional assays?

Rigorous controls are critical for MT-CO2 functional studies:

  • Negative controls:

    • Heat-denatured recombinant MT-CO2

    • Empty vector-transformed expression host extracts

    • Known inhibitors of cytochrome c oxidase (e.g., cyanide, azide)

  • Positive controls:

    • Commercially available cytochrome c oxidase

    • Well-characterized homologous protein from a model organism

  • Specificity controls:

    • Non-substrate cytochromes

    • Mutated recombinant MT-CO2 with altered active sites

  • Technical controls:

    • Assay in anaerobic conditions to confirm oxygen dependence

    • Buffer-only reactions to establish baseline measurements

    • Concentration gradients to confirm enzyme kinetics follow expected patterns

Document all control results thoroughly to demonstrate assay validity and reliability.

How might CRISPR-Cas9 technology advance Leggadina forresti MT-CO2 research?

CRISPR-Cas9 genome editing offers revolutionary possibilities for MT-CO2 research:

  • Create knock-in models expressing tagged versions of MT-CO2 in cell lines to study native interactions and trafficking.

  • Develop precise point mutations in conserved residues to evaluate their functional significance in cellular contexts.

  • Implement CRISPR interference (CRISPRi) to modulate MT-CO2 expression levels and assess phenotypic impacts on mitochondrial function.

  • Create humanized cell models with L. forresti MT-CO2 substituted for the endogenous version to investigate functional differences in a controlled genetic background.

When designing CRISPR studies, carefully select guide RNAs with minimal off-target effects, and include sequencing verification steps to confirm the precision of your genetic modifications.

What emerging technologies could transform our understanding of MT-CO2 structure and function?

Several cutting-edge technologies hold promise for advancing MT-CO2 research:

  • Cryo-electron microscopy: Now capable of near-atomic resolution for membrane proteins, potentially revealing detailed structural insights without crystallization.

  • AlphaFold and other AI structure prediction tools: Can provide highly accurate structural models to guide experimental design and interpretation.

  • Native mass spectrometry: Enables analysis of intact protein complexes, revealing interaction partners and stoichiometry of respiratory chain assemblies.

  • Single-molecule techniques: Including FRET and optical tweezers, can reveal dynamic conformational changes during electron transport.

  • In-cell NMR: Offers the possibility to study protein behavior in native cellular environments.

Combining these approaches will likely provide unprecedented insights into the structure-function relationships of MT-CO2 and its role in mitochondrial respiration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.