Recombinant Legionella pneumophila ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Role in Legionella Pathogenesis

Key findings:

  • ADP-ribosylation of ANTs: Ceg3 modifies arginine residues in the conserved -RRRMMM- motif of ANTs, blunting ATP/ADP transport .

  • Temporal regulation: ADP-ribosylation peaks at 10 hours post-infection, coinciding with maximal bacterial replication .

  • Mitochondrial membrane potential: L. pneumophila reverses host ATP synthase activity to ATP hydrolase, preserving mitochondrial membrane potential (Δψm) and delaying host cell death .

Vaccine Development

Recombinant atpB is utilized in vaccine research due to its immunogenic potential. Creative Biolabs offers this protein (aa 1–517) for preclinical studies targeting L. pneumophila infections .

Mechanistic Studies

  • Enzyme interactions: Used to study ADP-ribosylation by effectors like Ceg3 and its hydrolase counterpart Lpg0081 .

  • Mitochondrial manipulation: Helps elucidate how Legionella subverts host energy metabolism .

Challenges and Future Directions

  • Functional redundancy: Despite atpB’s role, L. pneumophila’s Dot/Icm secretion system delivers >330 effectors, complicating targeted studies .

  • Technical limitations: Recombinant atpB’s insolubility in E. coli necessitates refolding protocols for in vitro assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend centrifuging the vial briefly to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; lpp2331; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Legionella pneumophila (strain Paris)
Target Names
atpB
Target Protein Sequence
MGEEGFLAHFAFSIGGLPITQSVLTTWFIMISLFIMAWSTTYKCSLLQPSTYQLIWEGVL STMYDAIKEVLPDHVELIFPFVATLWIFILVSNLIGVIPGFYSPTADLSVTASLAIMTFL SVHWFGIRAEGWREYLKHYIKPTPFLLPFHLISEISRTLALAVRLFGNIMSLQLTALIVL MIAGFLVPIPILILHIIEAIIQAYIFGMLALIYIAGGIQAHELKSQGESL
Uniprot No.

Target Background

Function
This protein plays a crucial role in the proton channel, directly participating in the translocation of protons across the membrane.
Database Links

KEGG: lpp:lpp2331

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the relationship between L. pneumophila atpB and mitochondrial ATP synthase manipulation?

While direct evidence of L. pneumophila atpB's involvement in host mitochondrial manipulation is not definitively established, researchers should examine potential structural homology between bacterial atpB and host F₀F₁-ATPase components. The manipulation of host ATP synthase activity occurs in a T4SS-dependent manner, suggesting bacterial effector proteins rather than direct atpB involvement . Methodologically, comparative sequence analysis between bacterial atpB and mitochondrial ATP synthase subunits should be performed to identify conserved domains that might explain the bacteria's ability to manipulate host enzymes. Recombinant atpB could be used in binding assays with host ATP synthase components to determine if direct interactions occur.

How does the structure of L. pneumophila atpB compare to other bacterial ATP synthase subunits?

To address this question, researchers should employ multiple sequence alignment tools to compare atpB sequences across bacterial species, particularly focusing on other intracellular pathogens. Homology modeling using crystallographic data from well-characterized ATP synthases can help predict structural features unique to L. pneumophila. The bacterial F₀F₁-ATPase can function in both synthetic and hydrolytic modes similar to the mitochondrial counterpart that L. pneumophila manipulates during infection . Researchers should use recombinant atpB in structural studies (X-ray crystallography, cryo-EM) to determine if unique structural features exist that might contribute to the pathogen's specialized metabolism within host cells.

What role might atpB play in L. pneumophila's unique energy metabolism during infection?

Experimental approaches should measure ATP production in wild-type versus atpB-mutant L. pneumophila strains during different stages of infection. Since L. pneumophila manipulates host cell metabolism by reversing mitochondrial ATP synthase activity , bacterial atpB might be regulated differently during intracellular growth. Researchers should design assays that can distinguish between bacterial and host ATP production, perhaps using bacterial-specific ATP synthase inhibitors. Stable isotope labeling experiments can trace carbon flux through bacterial versus host metabolic pathways, helping elucidate atpB's role in bacterial energy acquisition during infection.

What expression systems optimize yield and folding of recombinant L. pneumophila atpB?

  • Cell-free expression systems that can incorporate detergents or nanodiscs during translation

  • Expression in Legionella itself for native post-translational modifications

  • Codon-optimization for the expression host

  • Lower induction temperatures (16-20°C) to improve folding

  • Co-expression with chaperones or other ATP synthase subunits

Expression should be verified by Western blotting, and functional integrity assessed by ATP hydrolysis assays similar to those used to study the "reverse mode" of mitochondrial F₀F₁-ATPase in infected cells .

How can researchers purify functional L. pneumophila atpB while maintaining native conformation?

Purification of membrane proteins like atpB presents significant challenges:

DetergentAdvantagesDisadvantagesRecommended Uses
DDMMild, maintains functionLarge micellesInitial extraction
LMNGStable, small micellesExpensiveCrystallization attempts
SMA polymersExtracts lipid nanodiscsLimited compatibilityFunctional studies

The purification protocol should include:

  • Gentle membrane solubilization with appropriate detergent

  • Affinity chromatography using His- or FLAG-tags

  • Size exclusion chromatography to separate monomeric atpB from aggregates

  • Reconstitution into proteoliposomes for functional studies

Similar approaches have been successful for analyzing F₀F₁-ATPase activity in studies of Legionella-host interactions .

What assays can assess interactions between recombinant atpB and host mitochondrial components?

Given that L. pneumophila manipulates mitochondrial ATP synthase , researchers should investigate potential interactions between bacterial atpB and host components:

  • Co-immunoprecipitation of recombinant atpB with host ATP synthase components from mitochondrial extracts

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • FRET-based assays using fluorescently-labeled atpB and host proteins

  • Proximity labeling approaches (BioID, APEX) in infection models

  • Yeast two-hybrid or bacterial two-hybrid screening

Controls must include:

  • Recombinant atpB from non-pathogenic bacteria

  • Host proteins not involved in ATP synthesis

  • Denatured proteins to control for non-specific binding

How does the reversal of host ATP synthase activity relate to bacterial ATP synthase function during infection?

This question addresses a fundamental aspect of L. pneumophila pathogenesis. Research shows that L. pneumophila reverses mitochondrial F₀F₁-ATPase activity from ATP-synthesis to ATP-hydrolysis in a T4SS-dependent manner . To investigate potential relationships:

  • Compare the directionality of bacterial atpB-containing ATP synthase during different infection stages

  • Determine if bacterial atpB undergoes post-translational modifications during infection

  • Investigate whether host-derived metabolites regulate bacterial ATP synthase activity

  • Use time-resolved techniques to correlate changes in bacterial and host ATP synthase activities

The finding that L. pneumophila induces the "reverse mode" of mitochondrial ATPase suggests the bacteria might coordinate its own energy metabolism with host manipulation .

What role might atpB play in mediating the effects of T4SS effectors on host mitochondria?

T4SS effectors are critical for L. pneumophila pathogenesis, including mitochondrial manipulation. The effector LpSpl is partially involved in conserving mitochondrial membrane potential , while Lpg0080 and Lpg0081 target mitochondrial ADP/ATP translocases . Researchers should:

  • Generate bacterial strains with tagged atpB to track its localization during infection

  • Investigate whether atpB interacts with known T4SS effectors using proximity labeling

  • Determine if atpB mutants affect the translocation or function of mitochondria-targeting effectors

  • Examine whether atpB and effectors like LpSpl coordinate to maximize bacterial benefit

A systems biology approach may help elucidate the network of interactions between bacterial ATP synthase components and effectors.

How do structural differences between bacterial atpB and host ATP synthase subunits influence pathogenesis?

This question requires detailed structural analysis:

  • Obtain high-resolution structures of recombinant L. pneumophila atpB using cryo-EM or X-ray crystallography

  • Compare with available structures of mitochondrial ATP synthase subunits

  • Identify unique structural features that might facilitate host manipulation

  • Design mutagenesis experiments targeting these unique features

Understanding these differences may explain how L. pneumophila maintains its own energy production while simultaneously manipulating host ATP production, particularly through the T4SS-dependent reversal of mitochondrial F₀F₁-ATPase activity .

How can researchers distinguish between bacterial and host ATP synthase activities in infection models?

This methodological challenge requires innovative approaches:

  • Use bacterial-specific ATP synthase inhibitors

  • Develop antibodies that specifically recognize bacterial atpB

  • Create reporter strains with tagged ATP synthase components

  • Employ stable isotope labeling to track ATP production sources

  • Use single-cell techniques to correlate bacterial replication with changes in ATP levels

In published work, researchers used specific inhibitors like oligomycin or DCCD to monitor changes in mitochondrial membrane potential (Δψm) after F₀F₁-ATPase inhibition, revealing the directionality of the enzyme during infection .

What contradictions exist in the current understanding of ATP synthase manipulation during L. pneumophila infection?

Several apparent contradictions need resolution:

  • L. pneumophila reduces oxidative phosphorylation but maintains mitochondrial membrane potential - researchers must explain this energetic paradox

  • The T4SS effector LpSpl is only partially involved in conserving Δψm , suggesting other unidentified factors

  • The relationship between F₀F₁-ATPase manipulation and ANT targeting by Lpg0080/Lpg0081 remains unclear

Researchers should design experiments that simultaneously monitor multiple parameters (membrane potential, ATP levels, effector localization) to reconcile these inconsistencies.

How should researchers integrate findings about recombinant atpB with in vivo infection data?

This methodological question addresses the translation between in vitro and in vivo studies:

  • Validate recombinant protein findings using bacterial genetics (atpB mutants)

  • Develop conditional expression systems to manipulate atpB levels during specific infection stages

  • Compare biochemical properties of recombinant atpB with native protein in bacterial membranes

  • Use computational modeling to predict how in vitro observations might manifest in infection models

The key is designing experiments that bridge artificial recombinant systems with the complex environment of infected cells, where multiple factors influence ATP synthase function simultaneously.

What potential exists for targeting L. pneumophila atpB in antimicrobial development?

ATP synthase represents an attractive drug target due to its essential function:

  • High-throughput screening of compound libraries against recombinant atpB

  • Structure-based drug design targeting unique features of bacterial atpB

  • Development of atpB-binding peptides derived from host interaction partners

  • Investigation of naturally occurring ATP synthase inhibitors

The pathogen's unique manipulation of host ATP synthase suggests bacterial ATP production might have specialized features worth targeting . Drug development should focus on compounds that selectively inhibit bacterial but not host ATP synthase.

How might atpB contribute to the reverse mode of ATPase activity observed in host mitochondria?

While evidence indicates L. pneumophila reverses host F₀F₁-ATPase activity via T4SS effectors , researchers should investigate:

  • Whether bacterial atpB shares structural homology with the regions of mitochondrial ATP synthase involved in directional switching

  • If recombinant atpB can directly influence the activity direction of isolated mitochondrial ATP synthase

  • Whether atpB plays a role in producing or delivering the effectors that cause the directional switch

Such studies might reveal evolutionary relationships between bacterial and mitochondrial ATP synthases that L. pneumophila exploits during infection.

What role might atpB play in the bacterial adaptation to different host environments?

L. pneumophila infects both environmental amoebae and human macrophages , environments with different metabolic characteristics:

  • Compare atpB expression and modification in different host cell types

  • Investigate whether atpB variants exist that are optimized for specific hosts

  • Determine if atpB contributes to metabolic flexibility during host switching

  • Examine atpB conservation across Legionella species with different host ranges

This research direction connects structural biology of recombinant atpB with ecological and evolutionary perspectives on L. pneumophila pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.