Recombinant Legionella pneumophila ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Production and Functional Validation

The recombinant atpF is synthesized using standard molecular biology techniques:

  1. Cloning: The atpF gene is inserted into plasmid vectors compatible with E. coli or yeast expression systems.

  2. Expression: Induced via IPTG (for E. coli) or galactose (for yeast), followed by cell lysis and solubilization.

  3. Purification: Affinity chromatography using nickel-NTA agarose to isolate His-tagged proteins .

Functional Relevance:
As part of the F₀ sector, atpF facilitates proton translocation across bacterial membranes, coupling ATP synthesis to the proton motive force. While the recombinant protein lacks the native membrane environment, it retains structural integrity for use in biochemical assays .

Biological Role in ATP Synthase

ATP synthase subunit B is critical for the F₀F₁ ATP synthase complex, which drives ATP production via oxidative phosphorylation. In Legionella pneumophila, this enzyme is essential for survival in intracellular niches. The recombinant atpF mirrors the native protein’s function in:

  • Proton Translocation: Facilitating H⁺ flux through the membrane-bound F₀ sector.

  • ATP Synthesis: Cooperating with subunits α and β in the F₁ sector to catalyze ATP formation .

Pathogen-Host Interaction Context

Though not directly studied with the recombinant atpF, Legionella pneumophila manipulates host mitochondria via effector proteins like Ceg3 (Lpg0080), which ADP-ribosylates mitochondrial ADP/ATP translocases (ANTs) to modulate energy metabolism . This highlights the broader relevance of ATP synthase-related proteins in bacterial pathogenesis.

Comparative Analysis with Homologs

Table 2: Recombinant ATP Synthase Subunit B Proteins

OrganismAA RegionExpression HostTagPuritySource
Legionella pneumophila1–156E. coli, YeastHis (N-term)>90%
Klebsiella pneumoniae1–156E. coliHis (N-term)N/A

Note: Klebsiella pneumoniae atpF shares 64% sequence identity with Legionella pneumophila atpF, underscoring conserved structural domains .

Future Directions

The recombinant atpF remains underexplored in functional studies. Potential avenues include:

  • Therapeutic Targeting: Investigating subunit B as a target for antimicrobial drugs.

  • Structural Studies: Solving its crystal structure to elucidate proton channel geometry.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format when placing the order, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage at -20°C/-80°C, we recommend adding 5-50% glycerol (final concentration) and aliquoting. Our standard glycerol concentration is 50%, which serves as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpF; LPC_3301; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Legionella pneumophila (strain Corby)
Target Names
atpF
Target Protein Sequence
MDINLTLIVQMLVFAAFVLFTMKLVWPPLAKALEERQDKIADGLAAAERGRKELELAQHRVKDELKQAKAHSADIIDKANKRASEIIEAAKEAAKREAQIQAKLAQEQIAQQVNHAKEELRKQVAKLAITGAEKILMREVDAKANSELLDNLIEEI
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase catalyzes the production of ATP from ADP in the presence of a proton or sodium gradient. This enzyme comprises two structural domains: F(1), which houses the extramembraneous catalytic core, and F(0), which contains the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The protein in question is a component of the F(0) channel, forming part of the peripheral stalk and connecting F(1) to F(0).
Database Links

KEGG: lpc:LPC_3301

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit b (atpF) in Legionella pneumophila?

The ATP synthase subunit b (atpF) in L. pneumophila is a critical component of the F0F1-ATPase complex, which is responsible for ATP synthesis and maintenance of the proton gradient across the bacterial membrane. The F0F1-ATPase can work in two directions: the "forward mode" where it synthesizes ATP using the proton gradient, and the "reverse mode" where it hydrolyzes ATP to maintain the membrane potential. In L. pneumophila, this ATP synthase complex plays a crucial role in energy metabolism and bacterial survival .

During infection, L. pneumophila manipulates the host cell's mitochondrial F0F1-ATPase, switching it from ATP synthesis to ATP hydrolysis (reverse mode) to maintain the mitochondrial membrane potential (Δψm) despite reduced oxidative phosphorylation. This mechanism helps delay host cell death and preserves the bacterial replication niche . The bacterial atpF subunit is part of the stator structure that anchors the catalytic components to the membrane, providing stability to the complex during the rotational catalysis process.

How does recombinant atpF protein differ from native atpF in Legionella pneumophila?

Recombinant L. pneumophila atpF protein is produced in expression systems such as E. coli, yeast, baculovirus, or mammalian cells, similar to other recombinant L. pneumophila proteins . The recombinant version typically includes only the amino acid sequence of the atpF protein without the native regulatory elements present in the bacterial genome. This difference may affect post-translational modifications and protein folding compared to the native form.

The native atpF exists in the context of the complete F0F1-ATPase complex and is regulated by bacterial genetic mechanisms, while the recombinant protein is isolated and may have additional features such as affinity tags for purification. These modifications, while necessary for laboratory work, can influence protein structure, function, and interaction capabilities. Researchers must consider these differences when interpreting experimental results with recombinant atpF compared to studies of the native protein in its bacterial context.

What expression systems are commonly used for producing recombinant L. pneumophila atpF?

Several expression systems are employed for producing recombinant L. pneumophila proteins, including the atpF subunit. These include E. coli, yeast, baculovirus, and mammalian cell expression systems . Each system offers distinct advantages for different research applications:

The choice of expression system depends on the specific research requirements, including protein purity needs, functional activity preservation, and experimental design constraints.

How does L. pneumophila manipulate host cell ATP synthase activity and what role might bacterial atpF play in this process?

L. pneumophila has evolved sophisticated mechanisms to manipulate host cell ATP synthase activity through its type 4 secretion system (T4SS). Research has revealed that L. pneumophila reverses the ATP-synthase activity of the mitochondrial F0F1-ATPase to ATP-hydrolase activity in a T4SS-dependent manner . This conversion from "forward mode" (ATP synthesis) to "reverse mode" (ATP hydrolysis) leads to conservation of the mitochondrial membrane potential (Δψm), preserves mitochondrial polarization, and prevents macrophage cell death despite reduced oxidative phosphorylation .

The bacterial atpF protein, while not directly identified in the search results as an effector protein, could potentially contribute to this process through several mechanisms. First, structural similarities between bacterial and mitochondrial ATP synthase components might enable molecular mimicry, where bacterial proteins interface with host machinery. Second, the bacterial atpF might serve as a template for effector proteins that target the host ATP synthase. Analysis of the L. pneumophila effector repertoire has identified 157 types of diverse functional domains in 287 effectors, including many with no prior functional annotations . These effectors could potentially interact with or modulate host ATP synthase components through structural similarities with bacterial ATP synthase subunits.

Studies have shown that certain T4SS effectors, such as LpSpl, are partially involved in conserving the Δψm during infection, while others like LncP and MitF are not . The inhibition of the L. pneumophila-induced 'reverse mode' of the F0F1-ATPase collapses the Δψm and causes cell death in infected cells . This underscores the importance of ATP synthase manipulation in L. pneumophila's pathogenic strategy.

What structural features of recombinant atpF are critical for its functional activity in experimental settings?

The structural features critical for recombinant atpF functional activity include:

  • Transmembrane domains: The atpF (subunit b) typically contains a single transmembrane helix at its N-terminus that anchors it in the membrane component (F0) of the ATP synthase. This domain must be properly folded and oriented for functional integration into membranes or membrane mimetics in experimental settings.

  • Dimerization interface: In many ATP synthases, subunit b forms homodimers that extend from the membrane into the cytoplasm. The residues involved in this dimerization are critical for structural stability.

  • Interaction domains: The C-terminal region of atpF interacts with the F1 portion of the ATP synthase, particularly with the delta and alpha subunits. These interaction sites must be preserved for proper complex assembly and function.

  • Secondary structure elements: The extended alpha-helical structure of most of the soluble portion of atpF is essential for its role as a peripheral stator, connecting the F0 and F1 domains and resisting torque during rotational catalysis.

When producing recombinant atpF, researchers must consider these structural features and ensure that expression systems, purification methods, and experimental conditions preserve them. For instance, detergent selection for membrane protein purification can significantly impact the native-like structure of the transmembrane domain. Similarly, buffer conditions must support the alpha-helical structure of the soluble domain.

The comprehensive structural analysis of L. pneumophila effectors has identified numerous functional domains that could share structural similarities with components of the ATP synthase complex . These insights may help guide the optimization of recombinant atpF production and functional assays.

What are the challenges in studying interactions between recombinant L. pneumophila atpF and host cell mitochondrial proteins?

Studying interactions between recombinant L. pneumophila atpF and host cell mitochondrial proteins presents several significant challenges:

  • Membrane protein reconstitution: Both bacterial atpF and its potential mitochondrial interaction partners are membrane proteins, which are notoriously difficult to work with in vitro. Maintaining native-like membrane environments while enabling controlled interaction studies requires sophisticated membrane mimetic systems like nanodiscs, liposomes, or detergent micelles.

  • Complex multi-protein assemblies: ATP synthase functions as a large multi-protein complex. Studying isolated subunit interactions may not recapitulate the behavior of the complete complex, where conformational changes and allosteric effects play important roles.

  • Temporal dynamics during infection: L. pneumophila manipulation of host mitochondrial functions changes over the course of infection. Early after infection, L. pneumophila reduces mitochondrial oxidative phosphorylation while maintaining the mitochondrial membrane potential (Δψm) . Recreating these temporal dynamics in vitro is challenging.

  • Bacterial effector interaction networks: L. pneumophila injects over 300 proteins into host cells via its T4SS . These effectors likely work in concert, making it difficult to isolate the specific contribution of bacterial atpF or its effects. Research has shown that effectors like LpSpl are partially involved in conserving the Δψm, suggesting multiple effectors may target mitochondrial functions redundantly .

  • Technical limitations in tracking protein-protein interactions: Common protein-protein interaction techniques like co-immunoprecipitation or yeast two-hybrid assays may not be well-suited for membrane proteins or may disrupt the native membrane environment necessary for physiologically relevant interactions.

Researchers often overcome these challenges by employing complementary approaches including biochemical reconstitution studies, structural biology techniques, live-cell imaging, and genetic manipulation of both bacterial and host components.

What purification strategies yield the highest activity for recombinant L. pneumophila atpF protein?

Purification of recombinant L. pneumophila atpF protein with high activity requires specific strategies to maintain the protein's native structure and function. Based on approaches used for similar membrane proteins and ATP synthase components, the following purification strategies are recommended:

  • Affinity chromatography with optimal tag placement: For recombinant atpF, N-terminal tags are generally preferred over C-terminal tags since the C-terminus often participates in critical interactions with other ATP synthase subunits. Histidine tags (His6 or His10) remain popular for initial capture, though Strep-tags or FLAG-tags may provide gentler elution conditions.

  • Membrane extraction optimization: Since atpF is a membrane protein, the choice of detergent is crucial. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin better preserve protein structure and activity compared to harsher detergents like Triton X-100. A staged solubilization approach, starting with a milder detergent and progressively moving to more effective ones only if necessary, often yields better results.

  • Size exclusion chromatography (SEC): SEC as a final purification step not only removes aggregates but also helps confirm the oligomeric state of the protein. For atpF, which typically exists as a dimer, SEC can verify proper assembly.

  • Ion exchange chromatography: Depending on the isoelectric point of L. pneumophila atpF, either cation or anion exchange chromatography can provide additional purification while maintaining native protein interactions.

  • Buffer optimization: The final buffer composition significantly impacts protein stability and activity. Typical buffers include:

    • 25-50 mM Tris or HEPES at pH 7.5-8.0

    • 100-200 mM NaCl to maintain ionic strength

    • 5-10% glycerol as a stabilizing agent

    • 0.01-0.05% of the chosen detergent (below critical micelle concentration)

    • 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation of cysteine residues

Activity assays should be performed at each purification step to track retention of function, as high purity does not always correlate with high activity for membrane proteins.

How can researchers effectively investigate the role of atpF in L. pneumophila's manipulation of host mitochondrial function?

Investigating atpF's role in L. pneumophila's manipulation of host mitochondrial function requires a multi-faceted approach:

  • Genetic manipulation strategies: Create atpF knockout or point mutant strains of L. pneumophila to assess changes in the bacterium's ability to manipulate host mitochondrial function. Complementation studies with wild-type atpF can confirm phenotype specificity. Techniques like CRISPR/Cas9 or allelic exchange can be used for precise genetic modifications.

  • Live-cell imaging approaches: Employ fluorescent probes such as TMRM (tetramethylrhodamine methyl ester) to monitor mitochondrial membrane potential (Δψm) in infected cells . This approach allows for single-cell analysis of mitochondrial function during infection. Multiplexing with Annexin-V can simultaneously track cell death events, as demonstrated in previous research on L. pneumophila infection .

  • Biochemical assays for ATP synthase directionality: Use established methods to determine ATP synthase directionality by monitoring changes in Δψm after adding inhibitors like oligomycin or DCCD (dicyclohexylcarbodiimide) . This approach can reveal whether the ATP synthase is working in "forward mode" (ATP synthesis) or "reverse mode" (ATP hydrolysis).

  • Protein-protein interaction studies: Employ proximity labeling techniques like BioID or APEX2, which are suitable for studying membrane protein interactions in their native environment. These methods can identify host mitochondrial proteins that interact with bacterial atpF or with L. pneumophila effectors that might mimic atpF function.

  • Comparative structural biology: Analyze structural similarities between bacterial atpF and components of the host ATP synthase or with known L. pneumophila effectors. Recent advances in protein structure prediction have enabled comprehensive analysis of L. pneumophila effectors , which could be extended to identify potential functional or structural relationships with atpF.

  • Temporal analysis during infection: Perform time-course experiments to track changes in mitochondrial function throughout infection. Previous research has shown that L. pneumophila reduces oxidative phosphorylation early after infection while maintaining the mitochondrial membrane potential , suggesting temporally coordinated manipulation of host functions.

By integrating these approaches, researchers can build a comprehensive understanding of atpF's potential role in L. pneumophila's sophisticated manipulation of host mitochondrial function.

What assays can accurately measure the enzymatic activity of recombinant L. pneumophila atpF in different experimental contexts?

Measuring the enzymatic activity of recombinant L. pneumophila atpF presents unique challenges since atpF (subunit b) itself does not possess catalytic activity but rather functions as part of the stator structure in the complete F0F1-ATPase complex. Therefore, activity assays typically focus on the following approaches:

  • Reconstitution assays with complete ATP synthase complex:

    • ATP synthesis activity: Measure ATP production using luciferase-based luminescence assays after reconstituting atpF with other ATP synthase subunits in proteoliposomes with an established proton gradient.

    • ATP hydrolysis activity: Quantify inorganic phosphate release using colorimetric assays (e.g., malachite green) or coupled enzyme assays that track NADH oxidation spectrophotometrically.

  • Protein-protein interaction assays to assess functional incorporation:

    • Surface Plasmon Resonance (SPR): Measure binding kinetics between purified atpF and other ATP synthase subunits, particularly those it directly interacts with (delta and alpha subunits).

    • Microscale Thermophoresis (MST): Assess protein-protein interactions in solution with minimal sample consumption.

    • Pull-down assays: Verify interactions between tagged recombinant atpF and other purified ATP synthase components.

  • Membrane potential measurements in reconstituted systems:

    • Potentiometric dyes: Use voltage-sensitive fluorescent dyes like DiSC3(5) or Oxonol VI in proteoliposomes containing reconstituted ATP synthase with recombinant atpF to monitor membrane potential generation or maintenance.

    • Patch-clamp electrophysiology: For more precise measurements of proton translocation activity in reconstituted membrane systems.

  • Structural integrity assessment as a proxy for function:

    • Circular Dichroism (CD) spectroscopy: Monitor the alpha-helical content of purified atpF, which is critical for its function.

    • Thermal shift assays: Measure protein stability, which often correlates with proper folding and functional capacity.

    • Limited proteolysis: Assess the structural integrity of the protein by its resistance to controlled protease digestion.

  • Cellular assays with recombinant protein introduction:

    • Microinjection of recombinant atpF: Directly deliver the protein into host cells and monitor changes in mitochondrial function using approaches similar to those used in L. pneumophila infection studies .

    • Cell-penetrating peptide fusions: Facilitate cellular uptake of recombinant atpF for functional studies in intact cells.

These assays should be selected based on the specific research question and experimental context, with appropriate controls to validate that observed effects are specifically attributable to the recombinant atpF protein.

How does the structure of L. pneumophila atpF compare to homologous proteins in other bacterial species and in mitochondria?

The structure of L. pneumophila atpF (ATP synthase subunit b) shares common architectural features with homologous proteins in other bacteria and in mitochondria, but also exhibits important differences that may relate to its specialized functions during host-pathogen interactions:

  • Core structural features preserved across species:

    • A single N-terminal transmembrane helix that anchors the protein in the membrane

    • An extended alpha-helical region forming a rigid peripheral stalk

    • A C-terminal domain that interacts with the F1 portion of the ATP synthase

  • Differences from other bacterial homologs:

    • Analysis of L. pneumophila effector proteins has revealed extensive adaptation to interact with eukaryotic host proteins . While not specifically mentioned for atpF in the search results, this pattern of adaptation might extend to ATP synthase components.

    • The bacterial ATP synthase subunit b typically forms homodimers, whereas some bacteria have heterodimeric arrangements (b and b'), which could affect structural stability and interactions with other subunits.

  • Comparison with mitochondrial counterparts:

    • Mitochondrial ATP synthase includes subunits b, d, and F6(h) that together form the peripheral stalk, compared to the typically homodimeric b subunit in bacteria.

    • The mitochondrial peripheral stalk has evolved additional structural features to accommodate the more complex regulation of the mitochondrial ATP synthase.

    • These structural differences may be relevant to how L. pneumophila manipulates host mitochondrial ATP synthase, as the bacterium has been shown to reverse the activity of the mitochondrial F0F1-ATPase from ATP synthesis to ATP hydrolysis .

  • Evolutionary implications:

    • Given that mitochondria evolved from bacterial endosymbionts, the similarities between bacterial and mitochondrial ATP synthase components reflect their common evolutionary origin.

    • The structural adaptation of L. pneumophila proteins to interact with host components represents a fascinating example of convergent evolution driven by the pathogen's intracellular lifestyle.

Recent advances in protein structure prediction tools have enabled more comprehensive analyses of bacterial proteins, including those from L. pneumophila . These approaches could reveal additional structural features of atpF that contribute to its role in bacterial physiology and potentially in host-pathogen interactions.

What potential post-translational modifications of recombinant atpF should researchers consider when designing experiments?

When working with recombinant L. pneumophila atpF, researchers should consider several potential post-translational modifications (PTMs) that could significantly impact protein function, interaction capabilities, and experimental outcomes:

  • Phosphorylation:

    • Serine, threonine, and tyrosine residues may be phosphorylated, affecting protein-protein interactions and structural dynamics.

    • ATP synthase components are known to be regulated by phosphorylation in various organisms, potentially altering the equilibrium between ATP synthesis and hydrolysis modes.

    • Expression systems differ in their phosphorylation patterns: mammalian and insect cell systems may provide more native-like phosphorylation compared to bacterial or yeast systems .

  • Lipid modifications:

    • As a membrane-associated protein, atpF may undergo lipid modifications that affect membrane targeting and insertion.

    • These modifications may be incompletely reproduced in heterologous expression systems, potentially affecting protein localization and function.

  • Proteolytic processing:

    • Signal peptides or pro-sequences may be processed differently in recombinant systems compared to native L. pneumophila.

    • Incomplete or incorrect processing can affect protein folding, targeting, and function.

  • Disulfide bond formation:

    • The oxidizing or reducing environment of different expression systems can affect the formation of native disulfide bonds.

    • E. coli cytoplasm is generally reducing, potentially preventing disulfide bond formation unless specific strains designed for disulfide bond formation are used .

  • Glycosylation:

    • While bacterial proteins typically undergo limited glycosylation compared to eukaryotic proteins, some bacterial proteins do exhibit glycosylation.

    • Expression in eukaryotic systems (yeast, insect, or mammalian cells) may introduce non-native glycosylation patterns.

Experimental design considerations to address these PTM issues include:

  • Expression system selection: Choose based on the PTMs most critical for the research question. Mammalian systems provide the most sophisticated PTM machinery but at higher cost and lower yield .

  • PTM analysis: Employ mass spectrometry to characterize the PTM profile of recombinant atpF compared to native protein isolated from L. pneumophila.

  • Site-directed mutagenesis: Create point mutants at potential PTM sites to assess their functional importance.

  • In vitro modification: For critical PTMs, consider enzymatic treatments to add or remove specific modifications after protein purification.

  • Buffer optimization: Include appropriate additives to maintain the stability of PTMs during purification and storage.

By carefully considering potential PTMs and their impact on protein function, researchers can design more robust experiments and better interpret results obtained with recombinant L. pneumophila atpF.

What is known about the interaction between L. pneumophila atpF and other subunits in the ATP synthase complex?

While the search results don't provide specific information about L. pneumophila atpF interactions, we can extrapolate from general knowledge of ATP synthase structure and function, supplemented by the specific findings about L. pneumophila's manipulation of mitochondrial ATP synthase:

  • Interaction with F0 membrane components:

    • The N-terminal transmembrane domain of atpF likely interacts with other F0 subunits, particularly the a-subunit and c-ring, helping anchor the peripheral stalk in the membrane.

    • These interactions are critical for maintaining the structural integrity of the ATP synthase complex during the rotational catalysis that drives ATP synthesis or hydrolysis.

  • Formation of the peripheral stalk:

    • In most bacterial ATP synthases, two b subunits form a homodimeric peripheral stalk that extends from the membrane to the F1 head.

    • This dimerization involves extensive coiled-coil interactions between the alpha-helical regions of the two b subunits, creating a rigid structure that resists the torque generated during catalysis.

  • Interface with F1 catalytic components:

    • The C-terminal region of atpF interacts primarily with the delta subunit and makes additional contacts with alpha subunits in the F1 portion.

    • These interactions are essential for coupling the rotation of the c-ring in F0 with the conformational changes in F1 that drive ATP synthesis or hydrolysis.

  • Dynamic interactions during different modes:

    • Research has shown that L. pneumophila manipulates the host mitochondrial ATP synthase, switching it from "forward mode" (ATP synthesis) to "reverse mode" (ATP hydrolysis) .

    • This functional reversal likely involves conformational changes in the interaction interfaces between subunits, potentially including homologs of atpF in the mitochondrial complex.

    • The bacterial atpF may serve as a template for effector proteins that target and modify these interactions in the host ATP synthase.

  • Regulatory interactions:

    • In some ATP synthases, the b subunit participates in regulatory interactions that modulate enzyme activity in response to cellular conditions.

    • These interactions might be particularly relevant for L. pneumophila, which must adapt to different environments during its lifecycle, from extracellular aquatic habitats to intracellular replication within host cells.

Understanding these interactions is crucial for researchers working with recombinant atpF, as experimental conditions that disrupt these interfaces may yield non-physiological results. Further structural and biochemical studies focused specifically on L. pneumophila ATP synthase components would help clarify the unique features of this pathogen's energy production machinery and its potential roles in virulence.

How might recombinant atpF be used to study the mechanisms of L. pneumophila pathogenesis?

Recombinant L. pneumophila atpF can serve as a valuable tool for investigating several aspects of pathogenesis:

  • Competitive inhibition studies: Purified recombinant atpF can be used to compete with native bacterial proteins for binding to host targets. By introducing recombinant atpF into host cells prior to infection, researchers can determine if it interferes with L. pneumophila's ability to manipulate host mitochondrial function. This approach could help identify host proteins that interact with bacterial ATP synthase components during infection.

  • Structure-function analysis of host-pathogen interactions: By creating a library of atpF mutants with specific domain alterations or point mutations, researchers can map the regions critical for L. pneumophila's manipulation of host mitochondrial ATP synthase. The finding that L. pneumophila reverses the ATP synthase activity from synthesis to hydrolysis mode suggests specific molecular interactions that could potentially involve bacterial ATP synthase components as models or competitors .

  • Vaccine development research: Recombinant bacterial proteins, including ATP synthase components, can be evaluated as potential vaccine candidates. While the search results mention that recombinant L. pneumophila proteins are available for research purposes only , the immunogenic properties of atpF could be assessed in pre-clinical models to determine its potential utility in vaccine formulations.

  • Antibody development and diagnostics: Recombinant atpF can be used to generate specific antibodies for immunolocalization studies, tracking the distribution of bacterial ATP synthase components during infection. These antibodies could also potentially be developed into diagnostic tools for detecting L. pneumophila infection.

  • Drug target validation: If atpF or its interactions prove important for pathogenesis, recombinant protein can be used in high-throughput screening assays to identify small molecules that disrupt these interactions. The finding that inhibiting the L. pneumophila-induced 'reverse mode' of the F0F1-ATPase causes collapse of mitochondrial membrane potential and host cell death suggests that modulating ATP synthase function could be a therapeutic strategy .

  • Cross-species comparative studies: By comparing recombinant atpF from L. pneumophila with homologs from other bacterial pathogens, researchers can investigate whether manipulation of host ATP synthase is a conserved virulence strategy or unique to Legionella.

These approaches leverage recombinant atpF as a tool to dissect the molecular mechanisms underlying L. pneumophila's sophisticated manipulation of host cell functions, potentially leading to new strategies for prevention and treatment of Legionnaires' disease.

What evidence suggests that bacterial ATP synthase components may be involved in host-pathogen interactions during Legionella infection?

Several lines of evidence suggest potential involvement of bacterial ATP synthase components in host-pathogen interactions during Legionella infection:

  • Manipulation of host mitochondrial ATP synthase: L. pneumophila has been shown to reverse the activity of the host mitochondrial F0F1-ATPase from ATP synthesis to ATP hydrolysis in a T4SS-dependent manner . This manipulation preserves the mitochondrial membrane potential (Δψm) despite reduced oxidative phosphorylation, preventing host cell death and preserving the bacterial replication niche . While this doesn't directly implicate bacterial ATP synthase components, it demonstrates the pathogen's sophisticated targeting of host ATP synthase function.

  • Structural similarities enabling molecular mimicry: Bacterial ATP synthase components, including atpF, share evolutionary relationships with their mitochondrial counterparts. This structural similarity could potentially enable molecular mimicry, where bacterial proteins directly interact with host machinery through conserved interfaces. The comprehensive structural analysis of L. pneumophila effectors has revealed numerous functional domains that could potentially include ATP synthase-like features.

  • T4SS effector targeting of mitochondrial functions: L. pneumophila injects over 300 proteins into host cells via its T4SS . Analysis of these effectors has shown that some target mitochondrial functions, including LpSpl which is partially involved in conserving the Δψm . The bacterial ATP synthase could serve as a template for the evolution of these effectors or contribute to their function through protein-protein interactions.

  • ATP synthesis reprogramming during infection: The manipulation of energy metabolism is a common strategy employed by intracellular pathogens. The alteration of host ATP synthase function by L. pneumophila suggests that energy production and utilization are critical aspects of the host-pathogen interaction. The bacterial ATP synthase may participate in this metabolic reprogramming directly or indirectly.

  • Single-cell analysis correlation with bacterial replication: Research has shown that bacterial replication occurs preferentially in host cells that maintain the Δψm and show delayed cell death . This correlation suggests that the manipulation of ATP synthase function is not merely a side effect of infection but a deliberately evolved virulence strategy that directly benefits the pathogen.

While direct evidence for the involvement of bacterial atpF in host-pathogen interactions is not provided in the search results, these observations collectively suggest that ATP synthase components may play important roles in L. pneumophila pathogenesis, either directly or as templates for effector proteins that target host energy metabolism.

How can researchers differentiate between the effects of bacterial atpF and host ATP synthase components during infection studies?

Differentiating between the effects of bacterial atpF and host ATP synthase components during infection studies requires sophisticated experimental approaches:

  • Genetic manipulation with epitope tagging:

    • Create L. pneumophila strains expressing epitope-tagged atpF (e.g., FLAG, HA, or GFP fusions) to track the bacterial protein during infection.

    • Use CRISPR/Cas9 to introduce equivalent tags into host ATP synthase components.

    • Employ dual-color immunofluorescence microscopy to simultaneously visualize bacterial and host proteins, revealing potential co-localization or distinctive distribution patterns.

  • Mass spectrometry-based approaches:

    • Utilize stable isotope labeling (SILAC or similar techniques) to distinguish bacterial from host proteins.

    • Perform crosslinking mass spectrometry to capture transient interactions between bacterial and host proteins.

    • Employ selective reaction monitoring (SRM) or parallel reaction monitoring (PRM) to quantify specific peptides unique to bacterial atpF versus host ATP synthase components.

  • Selective inhibition strategies:

    • Design RNA interference or antisense oligonucleotides that specifically target either bacterial atpF mRNA or host ATP synthase component mRNAs based on sequence differences.

    • Identify antibodies or nanobodies that selectively recognize bacterial versus host ATP synthase components and can be used as inhibitors when introduced into cells.

    • Use bacterial mutants with altered atpF compared to controlled expression of modified host components to dissect their respective contributions.

  • Temporal analysis of protein appearance and activity:

    • Monitor the timing of changes in ATP synthase activity relative to the appearance of bacterial proteins in the host cell.

    • Research has shown that L. pneumophila reduces oxidative phosphorylation early after infection , providing a temporal window to distinguish initial bacterial effects from subsequent host responses.

  • Species-specific functional assays:

    • Design biochemical assays that exploit known functional differences between bacterial and mitochondrial ATP synthases.

    • For example, differential sensitivity to specific inhibitors can help distinguish bacterial from host enzyme activity.

    • The directionality assay using inhibitors like oligomycin or DCCD to determine whether ATP synthase operates in "forward" or "reverse" mode could be adapted to differentiate between bacterial and host contributions.

  • Heterologous expression systems:

    • Express bacterial atpF in model cell systems lacking the targeted host ATP synthase component to isolate its effects.

    • Complement these studies with reciprocal experiments expressing host components in bacterial systems.

By integrating multiple approaches, researchers can build a comprehensive understanding of the distinct and potentially interacting roles of bacterial atpF and host ATP synthase components during L. pneumophila infection. This information could reveal new insights into the molecular mechanisms of pathogenesis and identify novel targets for therapeutic intervention.

What are promising research directions for understanding the role of atpF in L. pneumophila virulence?

Several promising research directions could advance our understanding of atpF's role in L. pneumophila virulence:

  • Structural biology approaches: Utilize cryo-electron microscopy and advanced protein structure prediction tools to determine the high-resolution structure of L. pneumophila ATP synthase, with particular focus on atpF. Recent advances in protein structure prediction have already enabled comprehensive analysis of L. pneumophila effectors , and similar approaches could reveal important structural features of atpF that contribute to virulence.

  • Single-cell infection dynamics: Expand on existing single-cell analysis approaches that have shown bacterial replication occurs preferentially in host cells maintaining mitochondrial membrane potential (Δψm) . Develop multi-parameter single-cell tracking to correlate ATP synthase activity, membrane potential, and bacterial replication in real-time during infection.

  • Comparative genomics across Legionella species: Analyze atpF sequence conservation and variation across pathogenic and non-pathogenic Legionella species to identify potential virulence-associated features. This evolutionary perspective could reveal adaptation signatures related to host-pathogen interactions.

  • Integrative multi-omics approach: Combine transcriptomics, proteomics, and metabolomics to create a systems-level understanding of how atpF contributes to L. pneumophila's metabolic adaptations during infection. This could reveal connections between ATP synthase function and other virulence mechanisms.

  • Investigation of potential secretion: Determine whether atpF or fragments thereof might be secreted or translocated into host cells during infection, potentially through the extensive T4SS that delivers over 300 effector proteins . If translocated, atpF could directly interact with host machinery.

  • Identification of host targets: Employ proximity labeling techniques like BioID or APEX2 to identify host proteins that interact with bacterial atpF or with the complete ATP synthase complex during infection. These interactions could reveal new aspects of host manipulation.

  • Development of atpF-targeted therapeutics: Based on unique structural or functional features of L. pneumophila atpF, design small molecule inhibitors or peptide-based agents that specifically target bacterial ATP synthase without affecting host mitochondrial function.

  • Investigation of cryptic domains: The recent analysis of L. pneumophila effectors identified 35 cryptic domains with no similarity to experimentally characterized proteins . Similar analysis of atpF could reveal unique functional domains that contribute to its role in virulence.

These research directions, pursued individually or in combination, could significantly advance our understanding of how L. pneumophila ATP synthase components, particularly atpF, contribute to the pathogen's remarkable ability to manipulate host cell functions and establish a replicative niche.

How might advances in structural biology and protein engineering be applied to study L. pneumophila atpF?

Advances in structural biology and protein engineering offer powerful approaches to study L. pneumophila atpF:

  • AlphaFold2 and RoseTTAFold implementation: These revolutionary AI-based protein structure prediction tools can generate highly accurate structural models of atpF, both in isolation and in complex with other ATP synthase components. Similar approaches have already been applied to predict structures of 368 L. pneumophila effectors, identifying 157 types of functional domains . Applying these tools to atpF could reveal structural features relevant to its function in bacterial physiology and potentially in host interactions.

  • Cryo-electron microscopy of ATP synthase complexes: Recent advances in cryo-EM have enabled determination of near-atomic resolution structures of complete ATP synthase complexes. This approach could reveal the precise arrangement of atpF within the L. pneumophila ATP synthase and how it differs from host mitochondrial ATP synthases, potentially identifying structural features that could be targeted for therapeutic development.

  • Integrative structural biology approaches: Combining multiple structural techniques (X-ray crystallography, NMR, SAXS, crosslinking mass spectrometry) can provide complementary information about atpF structure and dynamics, particularly for challenging regions like transmembrane domains or flexible linkers.

  • Structure-guided protein engineering:

    • Design atpF variants with enhanced stability or solubility for easier experimental manipulation.

    • Create chimeric proteins combining domains from bacterial and mitochondrial homologs to investigate functional differences.

    • Introduce non-canonical amino acids at specific positions to enable site-specific crosslinking, fluorescent labeling, or other modifications for tracking protein interactions.

  • Nanobody development: Generate and select nanobodies (single-domain antibodies) that specifically recognize conformational epitopes on atpF. These nanobodies can serve as crystallization chaperones for structural studies or as specific inhibitors for functional studies.

  • Reconstitution in membrane mimetics: Advanced membrane mimetic systems like nanodiscs, SMALPs (styrene-maleic acid lipid particles), or cell-derived vesicles provide more native-like environments for studying membrane proteins like atpF. These systems enable structural and functional studies in contexts that better preserve native interactions.

  • In silico molecular dynamics simulations: Using structural models as starting points, perform molecular dynamics simulations to investigate atpF's conformational dynamics, potential interaction interfaces, and responses to different environmental conditions.

  • Structure-based drug design: If atpF proves important for L. pneumophila virulence, its structural information could guide the design of specific inhibitors that disrupt its function or interactions without affecting host ATP synthase components.

These approaches can generate fundamental insights into atpF's structure-function relationships and potentially reveal new strategies for therapeutic intervention against Legionnaires' disease.

What collaborative research approaches could accelerate understanding of recombinant L. pneumophila atpF in pathogenesis?

Accelerating understanding of recombinant L. pneumophila atpF in pathogenesis would benefit from strategic collaborative research approaches:

  • Interdisciplinary research consortia: Form collaborations bringing together experts in:

    • Structural biology for high-resolution structural determination

    • Cellular microbiology for infection models and pathogenesis mechanisms

    • Biochemistry for protein function and enzyme kinetics

    • Bioinformatics for computational analysis and structural predictions

    • Clinical microbiology for connections to human disease

  • Technology platform integration: Combine multiple cutting-edge technologies:

    • Advanced imaging (super-resolution microscopy, correlative light and electron microscopy)

    • Systems biology approaches (multi-omics integration)

    • High-throughput screening for functional studies

    • Protein structure prediction and molecular dynamics simulations

    • Single-cell analysis technologies

  • Standardized reagent and protocol development:

    • Establish centralized repositories for validated recombinant proteins, including atpF variants

    • Develop standardized protocols for expression and purification

    • Create consistent infection models and readout systems

    • Share detailed methodologies for specialized techniques like ATP synthase activity assays

  • Open science initiatives:

    • Implement pre-registration of experimental designs

    • Develop open-access databases for experimental results

    • Establish data sharing platforms for raw data and analysis workflows

    • Create collaborative online workspaces for real-time research coordination

  • Industry-academic partnerships:

    • Collaborate with pharmaceutical companies interested in novel antimicrobial targets

    • Partner with biotechnology firms developing protein expression and purification technologies

    • Engage diagnostic companies for translational applications

  • Global surveillance network integration:

    • Connect basic research on atpF with surveillance of L. pneumophila strains

    • Analyze variations in atpF across clinical isolates

    • Correlate molecular findings with epidemiological data

  • Artificial intelligence implementation:

    • Use machine learning to predict structure-function relationships

    • Apply AI for image analysis in infection studies

    • Develop predictive models for atpF interactions with host proteins

  • Clinical research connections:

    • Establish biobanks of patient samples from Legionnaires' disease cases

    • Investigate correlations between bacterial genetic variations and disease severity

    • Explore potential diagnostic applications of anti-atpF antibody responses

By implementing these collaborative approaches, researchers can accelerate discovery while maximizing resource efficiency and minimizing redundant efforts. The complex nature of host-pathogen interactions during L. pneumophila infection makes such collaborative frameworks particularly valuable for achieving meaningful advances in understanding atpF's role in pathogenesis.

What are the most significant unanswered questions about L. pneumophila atpF that warrant further investigation?

Several significant unanswered questions about L. pneumophila atpF warrant dedicated research efforts:

  • Direct role in host-pathogen interactions: Is bacterial atpF directly involved in the manipulation of host mitochondrial function, or does it serve primarily as a template for effector proteins that target host ATP synthase? Research has established that L. pneumophila reverses the ATP-synthase activity of mitochondrial F0F1-ATPase to ATP-hydrolase activity , but the specific molecular mechanisms and potential role of bacterial ATP synthase components remain unclear.

  • Translocation potential: Can atpF or fragments thereof be translocated into host cells during infection? L. pneumophila injects over 300 proteins via its T4SS , but whether ATP synthase components might be among these effectors has not been established.

  • Structural adaptations: Does L. pneumophila atpF possess unique structural features compared to homologs in non-pathogenic bacteria that contribute to virulence? The recent structural analysis of L. pneumophila effectors has revealed numerous functional domains , suggesting that similar analysis of ATP synthase components might identify virulence-associated features.

  • Regulatory mechanisms: How is atpF expression and function regulated during different stages of L. pneumophila's lifecycle, from environmental aquatic habitats to intracellular replication within host cells? Adaptations to these dramatically different environments likely involve sophisticated regulation of energy metabolism.

  • Immunological significance: Does atpF elicit specific immune responses during infection, and could these responses contribute to protection or pathology? Understanding the immunogenicity of bacterial ATP synthase components could inform vaccine development strategies.

  • Evolutionary trajectory: How has atpF evolved across Legionella species, and do variations correlate with differences in virulence or host range? Comparative genomic analysis could reveal signatures of selection related to host adaptation.

  • Therapeutic targeting potential: Could atpF serve as a target for novel antimicrobial strategies? If it possesses unique features or functions essential for virulence, these could potentially be exploited for therapeutic intervention.

  • Mechanistic basis for "reverse mode" induction: How exactly does L. pneumophila induce the "reverse mode" of the mitochondrial F0F1-ATPase , and does this mechanism involve structural or functional similarities with bacterial ATP synthase components?

Addressing these questions would significantly advance our understanding of L. pneumophila pathogenesis and potentially reveal new approaches for prevention and treatment of Legionnaires' disease.

How might understanding L. pneumophila atpF contribute to broader knowledge in bacterial pathogenesis?

Understanding L. pneumophila atpF could contribute to broader knowledge in bacterial pathogenesis through several important mechanisms:

  • Novel paradigms in metabolic manipulation: L. pneumophila's ability to reverse mitochondrial ATP synthase activity from synthesis to hydrolysis mode represents a sophisticated strategy for manipulating host energy metabolism. Understanding the role of bacterial ATP synthase components in this process could reveal novel paradigms in how pathogens reprogram host metabolism to create favorable replication environments.

  • Evolutionary insights into host-adaptation: Comparing ATP synthase components across bacterial species that adopt different lifestyles (free-living, facultative intracellular, obligate intracellular) could reveal evolutionary trajectories of adaptation to host environments. The comprehensive analysis of L. pneumophila effectors has already identified diverse functional domains , and similar analysis of conserved machinery like ATP synthase might reveal parallel adaptation strategies.

  • Conservation of virulence mechanisms: Determining whether ATP synthase manipulation is a conserved virulence strategy across multiple intracellular pathogens could reveal fundamental principles of host-pathogen interactions. Findings from L. pneumophila could guide investigations in other systems where similar mechanisms might operate but have not yet been identified.

  • Mitochondrial targeting mechanisms: L. pneumophila's sophisticated manipulation of mitochondrial functions highlights the importance of this organelle in intracellular pathogen defense. Understanding how bacterial proteins target and modulate mitochondrial activities could reveal new aspects of mitochondrial biology relevant to multiple disease processes.

  • Structure-function relationships in molecular machines: ATP synthase is a remarkable molecular machine whose structure and function have been conserved across billions of years of evolution. Studying L. pneumophila atpF could reveal how pathogens may have adapted this machinery for specialized functions during infection, providing insights into molecular evolution of complex protein assemblies.

  • Novel antimicrobial strategies: If atpF proves important for L. pneumophila virulence, this could identify a new class of targets for antimicrobial development. Given the conservation of ATP synthase across bacterial species, comparative analysis could reveal pathogen-specific features that could be selectively targeted.

  • Host cell death modulation strategies: Research has shown that L. pneumophila's manipulation of ATP synthase helps delay host cell death, preserving the bacterial replication niche . Understanding this process could reveal broader principles about how pathogens modulate host cell death pathways to promote their own survival and replication.

These contributions would extend beyond Legionella research, potentially influencing how we understand and combat a wide range of bacterial pathogens.

What technological advances are needed to overcome current limitations in studying recombinant L. pneumophila atpF?

Several technological advances would help overcome current limitations in studying recombinant L. pneumophila atpF:

  • Improved membrane protein expression systems:

    • Development of specialized cell-free expression systems optimized for membrane proteins like atpF

    • Engineering of expression hosts with modified membrane compositions that better accommodate bacterial membrane proteins

    • Creation of fusion partners or scaffolds that enhance expression and proper folding of challenging membrane proteins without interfering with function

  • Advanced structural determination methods:

    • Further refinement of cryo-electron microscopy techniques for membrane protein complexes

    • Development of methods to determine structures of proteins in native membrane environments

    • Improved computational approaches to model dynamics and conformational changes in addition to static structures

  • Single-molecule techniques advancement:

    • Enhanced single-molecule FRET methods to track conformational changes in ATP synthase components during function

    • Improved super-resolution microscopy to visualize individual ATP synthase complexes in bacterial and host membranes

    • Advanced optical tweezers or magnetic tweezers to measure mechanical forces in ATP synthase during rotation

  • In situ protein interaction mapping:

    • Next-generation proximity labeling methods with increased spatial resolution and temporal control

    • Improved split-reporter systems for detecting protein-protein interactions in living cells

    • Methods to visualize protein interactions in the context of intact bacteria during host cell infection

  • Advanced membrane mimetic systems:

    • Development of improved nanodiscs or other membrane mimetics that better recapitulate native membrane environments

    • Cell-derived vesicle systems that maintain the complex lipid and protein composition of native membranes

    • Controllable reconstitution systems that allow precise manipulation of membrane protein complex assembly

  • High-throughput functional assays:

    • Miniaturized assays for ATP synthase activity compatible with high-throughput screening

    • Multiplexed single-cell analysis platforms to simultaneously track multiple parameters during infection

    • Microfluidic systems for real-time monitoring of bacterial-host interactions

  • Genetic manipulation tools:

    • Improved methods for precise genetic manipulation of L. pneumophila that overcome current limitations

    • Development of inducible and reversible gene expression or protein degradation systems for temporal control

    • Enhanced site-specific incorporation of non-canonical amino acids for specialized labeling and crosslinking

  • Computational prediction tools:

    • Improved algorithms for predicting protein-protein interactions across species boundaries

    • Enhanced molecular dynamics simulations that can model large complexes like ATP synthase over relevant timescales

    • Integrated modeling approaches that combine experimental data with computational prediction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.