Recombinant Legionella pneumophila Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; LPC_3318; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
full length protein
Species
Legionella pneumophila (strain Corby)
Target Names
yidC
Target Protein Sequence
MDIRRIVLYMALALIGLSLWNAWQIDYPAAQPVEDKTASQLTSDGHLLPQIIPSNAEQPV TLKAEEKASSGKQLIQVKTDVLDVGIDLKNGDIVKGLLLDYPLSVEDKNKPFPLLQNQAS QRYVANSSLFVLDGQTPQSLDFDFTSEKEYYELKPDQNQLIVTLNGKSEDGLDVKKEFVF TKGSYLIEVNYKIANTGNSLWKGYFNTQLLRSSPKEDKSSIFHIGSYTGASFSNPGKNRY QKVSFSDMSKSNLDVDAKGGWIAMQQHYFLSAWVPNADSENKFYTLATDKDYTIGAVSQP ITVKPKEDKIVGSKLYIGPEITSVLKGISPSLDLTVDYGILWFLSSLLFSLMKAIYTVVG NWGWSIVLVTVLIKLAFYRLSATSYKSMASMRKLQPKLQALRERYGDDKAKISQATMELY KQEKVNPLGGCLPILIQIPVFIALYWVLLESVELRQAPFIFWINDLASADPYHVLPLIMG ATMLIQQKLNPAPADPMQAKVMMFLPILFTGLFWNFPSGLVLYWIVNNTLSILQQWYITR KYSDEKPAKKVVATAK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: lpc:LPC_3318

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what role does it play in Legionella pneumophila?

YidC is a membrane protein insertase that plays a crucial role in the assembly of membrane proteins into the bacterial cytoplasmic membrane. In Legionella pneumophila, YidC functions alongside the SecYEG translocon to facilitate the insertion of hydrophobic proteins into the bacterial inner membrane . This protein belongs to the evolutionarily conserved YidC/Oxa1/Alb3 family found across bacteria, mitochondria, and chloroplasts, which are essential for membrane protein biogenesis. In bacterial systems like Legionella, YidC can function both independently and in cooperation with the Sec translocon to ensure proper folding and assembly of transmembrane proteins that are critical for bacterial survival and virulence.

The YidC protein in Legionella pneumophila strain Paris consists of 556 amino acids and functions as an integral membrane protein . Its proper function is essential for the organism's cellular physiology, as it ensures correct membrane protein topology and assembly, which in turn affects numerous cellular processes including respiration, cell division, and potentially virulence factor secretion.

How does Legionella pneumophila YidC compare to homologs in other bacterial species?

Legionella pneumophila YidC shares structural and functional similarities with homologs in other gram-negative bacteria, though with species-specific adaptations. While the core functional domain is conserved across bacterial species, variations in the N-terminal and periplasmic domains likely reflect adaptations to Legionella's specific environmental niche and pathogenic lifestyle.

What experimental approaches are effective for studying YidC function in Legionella pneumophila?

Several complementary approaches can be employed to study YidC function in Legionella pneumophila:

  • Genetic manipulation techniques: Generating YidC deletion mutants or conditional mutants using modern genetic tools, though challenging due to YidC's essential nature. Approaches may include:

    • CRISPR-Cas9 genome editing with inducible promoters

    • Site-directed mutagenesis to create point mutations in functional domains

    • Construction of depletion strains with titratable expression systems

  • Protein-protein interaction studies: Identifying YidC interaction partners using techniques such as:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation followed by mass spectrometry

    • Chemical crosslinking coupled with proteomics

  • Localization studies: Similar to methodologies used for Dot/Icm components, researchers can employ:

    • Fluorescence microscopy with YidC-GFP fusions

    • Immunogold electron microscopy for high-resolution localization

    • Super-resolution microscopy techniques like STORM or PALM

  • In vitro reconstitution: For biochemical characterization of YidC function:

    • Purification of recombinant YidC and reconstitution into proteoliposomes

    • Development of cell-free translation systems supplemented with YidC-containing membranes

    • Substrate translocation assays using purified components

These methodologies can be adapted from approaches used to study the Dot/Icm secretion system components, which have been successfully localized to the bacterial poles using immunofluorescence techniques with specific antibodies .

How can researchers express and purify recombinant Legionella pneumophila YidC for structural studies?

For structural studies of Legionella pneumophila YidC, researchers can employ the following expression and purification strategy:

Expression systems:

  • E. coli-based expression using specialized strains designed for membrane protein expression (C41/C43 or Lemo21)

  • Yeast expression systems (Pichia pastoris) for eukaryotic-like post-translational modifications

  • Baculovirus expression systems for higher yields of complex membrane proteins

  • Mammalian cell expression for proper folding of eukaryotic-interacting domains

Expression optimization:

  • Construct design with removable fusion tags (His, GST, MBP) to enhance solubility

  • Codon optimization for the expression host

  • Induction conditions optimization (temperature, inducer concentration, duration)

  • Co-expression with chaperones to improve folding

Purification protocol:

  • Membrane fraction isolation via ultracentrifugation

  • Solubilization using mild detergents (DDM, LMNG, or CHAPS)

  • Affinity chromatography using engineered tags

  • Size exclusion chromatography for final purification

  • Detergent exchange or reconstitution into nanodiscs or amphipols for structural studies

For cryo-EM or X-ray crystallography studies, additional steps may include detergent screening, lipid supplementation, and complex formation with known binding partners to stabilize the protein in its native conformation.

What is the potential relationship between YidC and the Dot/Icm type IV secretion system in Legionella?

The relationship between YidC and the Dot/Icm type IV secretion system represents an intriguing area of research with significant implications for understanding Legionella pathogenesis. Based on current knowledge of bacterial secretion systems, several potential interactions can be hypothesized:

  • Competition for membrane protein substrates: The search results indicate that "Chaperones for the Dot/Icm machinery, such as IcmS, IcmW and LvgA must be in active competition with the bacterial YidC/SecYEG machinery to dictate which integral membrane proteins will be assembled into the bacterial inner membrane and which will be evacuated via the Dot/Icm T4SS" . This suggests a critical interplay between these systems in determining protein fate.

  • Potential role in secretion apparatus assembly: The Dot/Icm secretion system is specifically localized to the bacterial poles, which is essential for effective delivery of effector proteins into host cells . YidC might potentially contribute to the correct assembly and localization of Dot/Icm components at the poles, ensuring proper secretion system functionality.

  • Indirect effects on virulence: Studies have demonstrated that polar secretion of Dot/Icm effectors is "critically required for Legionella's alteration of the host endocytic pathway" . If YidC influences the assembly or localization of this secretion system, it would indirectly affect the bacterium's virulence.

Experimental approaches to investigate these relationships could include:

  • Co-localization studies of YidC with Dot/Icm components

  • Analysis of Dot/Icm function in YidC-depleted cells

  • Identification of shared substrates between YidC and the Dot/Icm machinery

What are the challenges in studying membrane protein insertases like YidC in Legionella pneumophila?

Studying membrane protein insertases like YidC in Legionella pneumophila presents several challenges:

  • Essential nature of the protein: YidC typically performs essential functions, making traditional knockout approaches problematic. Researchers must employ conditional expression systems or partial depletion strategies to study its function without completely compromising bacterial viability.

  • Hydrophobicity and membrane integration: As an integral membrane protein with multiple transmembrane segments, YidC is highly hydrophobic and difficult to work with biochemically. Purification requires careful optimization of detergents that maintain protein structure while extracting it from the membrane.

  • Complex in vivo interactions: YidC functions within a network of protein interactions, including the SecYEG translocon and substrates. Studying these interactions in isolation may not reflect the true in vivo situation, particularly when considering the specialized intracellular environment of Legionella within macrophages.

  • Functional redundancy: Bacteria often possess backup systems for essential functions. In some species, multiple YidC homologs exist, potentially complicating genetic approaches through functional compensation.

  • Technical limitations in Legionella genetics: While genetic manipulation of Legionella has improved, it remains more challenging than in model organisms like E. coli, requiring specialized techniques and considerations for this facultative intracellular pathogen.

These challenges necessitate multidisciplinary approaches combining genetics, biochemistry, structural biology, and cell biology to fully understand YidC function in Legionella pneumophila.

How might YidC function influence Legionella's intracellular lifestyle and host interaction?

YidC function may significantly impact Legionella's intracellular lifestyle through several mechanisms:

  • Assembly of virulence factors: YidC likely participates in the membrane insertion of various proteins essential for virulence, including components of secretion systems, adhesins, and membrane transporters. Proper assembly of these proteins is crucial for Legionella's ability to manipulate host cells.

  • Secretion system functionality: Legionella's Dot/Icm type IV secretion system is central to its pathogenesis, injecting approximately 275 effector proteins into host cells . The secretion system is specifically localized to bacterial poles, and this polar localization is essential for virulence . YidC may contribute to the proper assembly and localization of secretion system components.

  • Bacterial adaptation to the intracellular environment: Within macrophages, Legionella must adapt to changing environmental conditions. YidC-mediated membrane protein insertion likely plays a role in modifying the bacterial membrane composition in response to intracellular cues.

  • Potential role in effector translocation: The search results indicate that some effectors, like LncP, must avoid the YidC/SecYEG machinery to be recognized by the Dot/Icm system for secretion . This suggests a complex interplay between these systems in determining which proteins remain in the bacterial membrane versus those that are secreted into host cells.

Investigating these aspects could involve comparing membrane proteome composition under YidC depletion conditions, assessing secretion system assembly and function when YidC levels are altered, and examining host cell responses to infection with YidC-depleted Legionella strains.

How do recent findings about bacterial protein localization impact our understanding of YidC function in Legionella?

Recent discoveries regarding protein localization in bacteria have significant implications for understanding YidC function in Legionella pneumophila:

  • Polar localization mechanisms: Research has revealed that "a number of mechanisms have been proposed to explain how bacteria target proteins to their poles" . The most common involves a "diffusion and capture" mechanism where proteins encounter factors already at the pole and become trapped there. Similar mechanisms might govern YidC localization or the localization of YidC substrates, potentially concentrating certain membrane proteins at specific cellular regions.

  • Significance of polar secretion: Studies have demonstrated that "the Dot/Icm secretion system is restricted to both poles of the bacterium and its localization is a key feature of L. pneumophila's virulence, because nonpolar export of Dot/Icm effectors is ineffectual" . This highlights the critical importance of proper protein localization for bacterial pathogenesis and suggests that YidC-mediated membrane protein insertion may need to be spatially regulated within the bacterial cell.

  • Protein targeting during cell division: Research indicates that "the localization [of Dot/Icm components] appears to be initiated by targeting components of the T4SS to the bacterial midcell during cell division" . This suggests complex spatial and temporal regulation of protein localization, potentially involving YidC-mediated insertion at specific cellular locations during different growth phases.

These findings suggest that YidC function in Legionella may be spatially regulated, potentially contributing to the establishment of bacterial cell polarity that is critical for effective host cell manipulation through polar secretion systems.

What are promising therapeutic targets related to YidC function in Legionella pneumophila?

YidC and related pathways present several promising therapeutic targets for treating Legionella infections:

  • YidC inhibition strategies: As an essential membrane protein insertase, compounds that specifically inhibit YidC function could potentially disrupt multiple aspects of Legionella physiology. Potential approaches include:

    • Small molecule inhibitors targeting the substrate-binding site

    • Peptide mimetics that compete with natural substrates

    • Compounds disrupting YidC interaction with partner proteins

  • Targeting polar localization mechanisms: Since polar localization of secretion systems is critical for Legionella virulence , compounds that disrupt the spatial organization of bacterial cells might effectively attenuate pathogenesis without directly killing bacteria, potentially reducing selective pressure for resistance.

  • SecYEG-YidC interface disruption: Compounds targeting the interface between YidC and the SecYEG translocon could specifically disrupt the coordinated insertion of complex membrane proteins while leaving other cellular functions intact.

  • Substrate-specific approaches: Identification of virulence-associated membrane proteins that specifically require YidC for insertion could lead to targeted interventions that selectively inhibit pathogenesis without broadly affecting bacterial viability.

When developing such approaches, researchers must consider the conservation of YidC across bacterial species, as high conservation could lead to broad-spectrum activity but might also affect beneficial microbiota. Conversely, targeting Legionella-specific features of YidC or its substrates could provide more selective therapeutic options.

How can researchers effectively study the interaction between YidC and the Dot/Icm secretion system in Legionella?

To effectively study interactions between YidC and the Dot/Icm secretion system, researchers can employ several complementary approaches:

  • Co-localization studies:

    • Fluorescently tag YidC and Dot/Icm components with different fluorophores

    • Use super-resolution microscopy techniques to precisely map their spatial relationship

    • Employ techniques similar to those used to show that "components of the Dot/Icm T4SS localize to both bacterial poles"

  • Protein-protein interaction analysis:

    • Bacterial two-hybrid or split-protein complementation assays to detect direct interactions

    • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Crosslinking studies to capture transient interactions

    • FRET-based approaches to measure proximity in living cells

  • Functional interference studies:

    • Create YidC depletion strains and assess Dot/Icm assembly and function

    • Design YidC variants with mutations in specific domains and test their impact on Dot/Icm localization

    • Develop methods similar to the "intracellular effector staining" techniques described for Dot/Icm effectors

  • Shared substrate identification:

    • Comparative proteomics of membrane and secreted fractions under YidC depletion conditions

    • Pulse-chase experiments to track substrate fate

    • In vitro reconstitution of membrane protein insertion using purified components

  • Competition assays:

    • Design experiments to test the hypothesis that "Chaperones for the Dot/Icm machinery... must be in active competition with the bacterial YidC/SecYEG machinery"

    • Develop reporter systems to monitor substrate fate when levels of YidC or Dot/Icm components are manipulated

These approaches would help elucidate the hypothesized competition between these systems and reveal how membrane protein fate decisions influence Legionella virulence.

What control experiments are essential when evaluating YidC function in Legionella?

When designing experiments to evaluate YidC function in Legionella pneumophila, several critical controls must be included:

These controls ensure that observed phenotypes are specifically attributed to YidC function rather than experimental artifacts or indirect effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.