Recombinant Legionella pneumophila NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
nuoK; LPC_3065; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Legionella pneumophila (strain Corby)
Target Names
nuoK
Target Protein Sequence
MIPVYDYLVLGVILFGLSLVGIMLNRKNIILLLVCVELMLLAVNTNFIAFSHYYNEVGGQ VFVFFILTVAAAEAAIGLAIVMLLYRNRGNIDVDKMNHLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.
Database Links

KEGG: lpc:LPC_3065

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its functional role?

NuoK is one of the seven hydrophobic subunits in the membrane domain of bacterial H+-translocating NADH:quinone oxidoreductase (NDH-1). This enzyme catalyzes electron transfer from NADH to quinone coupled with proton pumping across the cytoplasmic membrane . NuoK is the bacterial counterpart of the mitochondrial ND4L subunit and bears three transmembrane segments (TM1-3) .

From a functional perspective, nuoK contributes significantly to the proton translocation mechanism of NDH-1. The subunit contains two conserved glutamic acid residues in adjacent transmembrane helices (KGlu-36 in TM2 and KGlu-72 in TM3) that are critical for the energy-coupled activity of NDH-1 . The subunit has extensive interaction with the NuoN subunit, with its C terminus extending between NuoN and an α-helix of NuoL that spans multiple subunits, forming numerous inter-subunit links .

The NDH-1 complex has been implicated in several human neurodegenerative disorders and is believed to be a principal source of reactive oxygen species in mitochondria, highlighting the broader significance of understanding nuoK function .

How is recombinant nuoK typically produced for research applications?

Recombinant full-length Legionella pneumophila NADH-quinone oxidoreductase subunit K can be produced with an N-terminal His tag expressed in E. coli expression systems . The product specifications indicate that the protein is provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

For reconstitution, researchers should briefly centrifuge the vial prior to opening to bring the contents to the bottom, then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage stability, adding glycerol to a final concentration of 5-50% (with 50% being recommended) and aliquoting for storage at -20°C/-80°C is advised .

The storage buffer typically consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . It's important to note that repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

What are the synonyms and identifiers associated with nuoK?

For researchers searching literature or databases, it's helpful to know the various identifiers and synonyms associated with nuoK:

Identifier/SynonymValue
Gene NamenuoK
SynonymsnuoK; lpp2826; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
UniProt IDQ5X1B7

These identifiers help ensure proper identification of the protein across different research contexts and database searches .

Which amino acid residues are critical for nuoK function and how do mutations impact activity?

Several key residues have been identified as critical for nuoK function through mutagenesis studies:

  • Glutamic Acid Residues in Transmembrane Helices:

    • KGlu-36 in TM2: This highly conserved carboxyl residue is crucial for activity. Mutation to Ala or Gln led to complete loss of NDH-1 activities .

    • KGlu-72 in TM3: This second conserved carboxyl residue is also important, though mutations here cause only moderate reduction in activities .

  • Positional Tolerance of KGlu-36:
    When KGlu-36 was relocated along TM2 to positions 32, 38, 39, and 40, the mutants largely retained energy transducing NDH-1 activities . This suggests some positional flexibility as long as the residue remains within the same helix phase, in the immediate vicinity of the original position .

  • Arginine Residues in Cytoplasmic Loop:

    • KArg-25 and KArg-26: A double mutation (R25A/R26A) of these two arginine residues located in the cytoplasmic loop connecting TM1 and TM2 showed a drastic effect on energy transducing activities, with greatly reduced electron transfer rates and a diminished electrochemical gradient .

These findings indicate that the charged residues in nuoK participate either directly or indirectly in the coupling mechanism of NDH-1, potentially in conjunction with NuoA and NuoJ subunits .

How does the membrane topology of nuoK contribute to its functional mechanism?

The membrane topology of nuoK is critical to understanding its role in proton translocation. While the search results don't provide specific topology mapping for L. pneumophila nuoK, they do describe methodologies used for related proteins that could be applied to nuoK .

The three transmembrane segments of nuoK are arranged linearly and connected by short loops . Of particular importance is the short cytoplasmic loop (loop-1) between TM1 and TM2, which contains the functionally significant residues KArg-25, KArg-26, and KAsn-27 .

The critical glutamic acid residues KGlu-36 and KGlu-72 are positioned in the middle of TM2 and TM3 respectively . Their location within the membrane is likely crucial for their role in proton translocation.

Based on studies of similar respiratory enzymes, it appears that all redox cofactors of NDH-1 are localized to the cytoplasmic side of the membrane . This arrangement has important implications for the mechanism of energy transduction, as it suggests a specific directionality to the proton pumping process.

How does nuoK compare to homologous proteins in other bacterial species?

Understanding these evolutionary relationships can provide insights into the functional constraints on nuoK and help identify which structural features are essential for its specific role in L. pneumophila.

What role might nuoK play in L. pneumophila pathogenicity and host adaptation?

While the search results don't directly address the role of nuoK in pathogenicity, we can make informed inferences based on the broader context of L. pneumophila biology:

L. pneumophila is a protozoan parasite and accidental intracellular pathogen of humans . The bacterium has evolved to replicate within different host cells, including environmental amoebae and human macrophages . This versatility requires metabolic adaptability.

Experimental evolution studies have shown that restriction to growth within mouse macrophages for hundreds of generations leads to adaptive mutations and population dynamics that improve replication within macrophages . This demonstrates that host environment can drive rapid evolutionary changes in L. pneumophila.

As a component of the respiratory chain, nuoK contributes to energy metabolism, which is crucial for bacterial survival and replication within host cells. L. pneumophila primarily utilizes amino acids (particularly glutamate, serine, threonine, and tyrosine) as energy sources, along with compounds like lactate, pyruvate, acetate, fumarate, and succinate . The efficient functioning of NDH-1, including the nuoK subunit, would be necessary for optimal utilization of these energy sources.

The regulatory networks controlling nuoK expression in different host environments and the potential impacts of nuoK mutations on host adaptation represent promising areas for future research into L. pneumophila pathogenicity.

What expression systems and purification strategies are optimal for recombinant nuoK?

For researchers seeking to produce recombinant nuoK protein for experimental studies, the following methodological considerations are important:

  • Expression System: E. coli has been successfully used as an expression host for recombinant L. pneumophila nuoK protein with an N-terminal His tag . This system appears capable of correctly expressing the full-length protein (1-101 amino acids).

  • Purification Strategy: Affinity chromatography using the His tag is an effective purification approach, capable of achieving >90% purity as determined by SDS-PAGE .

  • Protein Form: The purified protein is typically provided as a lyophilized powder, which offers stability for shipping and storage .

  • Reconstitution Protocol:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to 5-50% final concentration

    • Aliquot and store at -20°C/-80°C

The optimal expression and purification conditions may need to be empirically determined for specific experimental applications, particularly if functional studies requiring proper folding and membrane insertion are planned.

What approaches can be used to study nuoK membrane topology?

Understanding the membrane topology of nuoK is crucial for elucidating its functional mechanism. Based on methodologies described for related membrane proteins, researchers can employ several complementary approaches:

  • Computational Prediction:

    • Multiple topology prediction algorithms can provide initial models of transmembrane helix arrangement

    • These predictions serve as a foundation for experimental validation

  • Reporter Fusion Analysis:

    • C-terminal fusions with reporter proteins can experimentally map topology:

      • Bacterial alkaline phosphatase (phoA) as a reporter of periplasmic localization

      • Green fluorescent protein (gfp) as a reporter of cytoplasmic localization

    • By creating multiple fusion constructs with truncations at different points in the sequence, researchers can systematically map which regions are exposed to which side of the membrane

  • Site-directed labeling:

    • Introduction of cysteine residues at specific positions followed by accessibility studies with membrane-permeable and impermeable sulfhydryl reagents

    • This approach can provide detailed information about the accessibility of specific residues

  • Protease protection assays:

    • Treatment of membrane preparations with proteases to determine which regions are protected by the membrane

These approaches, used in combination, can provide a comprehensive model of nuoK membrane topology that informs functional studies.

What mutagenesis strategies are most informative for structure-function analysis of nuoK?

Based on previous studies, several mutagenesis approaches have proven valuable for understanding nuoK function:

  • Alanine Scanning Mutagenesis:

    • Systematic replacement of charged or conserved residues with alanine

    • This approach identified the critical nature of KGlu-36 and KGlu-72

  • Conservative Substitutions:

    • Replacing residues with chemically similar alternatives (e.g., Glu→Gln) to distinguish between charge-dependent and structure-dependent effects

  • Positional Shifting:

    • Relocating key residues along the same transmembrane helix

    • This approach revealed that KGlu-36 function is partially preserved when shifted to nearby positions in the same helix phase

  • Double Mutations:

    • Creating combinations of mutations to test functional interactions

    • The R25A/R26A double mutant demonstrated the importance of the TM1-TM2 loop

  • Cross-species Chimeras:

    • Creating hybrid proteins with segments from nuoK homologs in other species

    • This can help identify species-specific functional regions

Each of these approaches provides different insights into structure-function relationships. Combining mutagenesis with activity assays and structural studies creates a comprehensive understanding of how nuoK contributes to NDH-1 function.

How can the functional activity of nuoK be measured in experimental settings?

Assessing the functional impact of nuoK mutations or manipulations requires appropriate activity assays. While the search results don't provide explicit protocols for nuoK-specific assays, several approaches can be inferred:

  • Electron Transfer Activity:

    • Measuring the rate of NADH oxidation spectrophotometrically

    • Monitoring quinone reduction

    • These assays can determine if the electron transfer function of NDH-1 is preserved

  • Proton Pumping Activity:

    • Using pH-sensitive fluorescent dyes to monitor pH changes

    • Employing artificial membrane systems with reconstituted protein

    • These approaches can assess if the ion translocation function remains intact

  • Membrane Potential Measurements:

    • Using voltage-sensitive dyes to detect changes in membrane potential

    • This can indicate if the energy conservation function of the enzyme is maintained

  • Growth Complementation Assays:

    • Testing if mutant nuoK can restore growth in nuoK-deficient bacterial strains

    • This provides a physiologically relevant assessment of function

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation or crosslinking studies to assess interaction with other NDH-1 subunits

    • This can determine if mutations affect the proper assembly of the NDH-1 complex

For recombinant nuoK analysis, researchers would typically need to reconstitute it with other NDH-1 subunits or into liposomes to form functional complexes before conducting these assays.

What are the most promising avenues for advancing nuoK research?

Based on the current state of knowledge about nuoK, several research directions hold particular promise:

  • High-Resolution Structural Studies:

    • Cryo-electron microscopy of the intact NDH-1 complex from L. pneumophila

    • X-ray crystallography of nuoK alone or in subcomplexes

    • These approaches could reveal the precise arrangement of critical residues and their relationships to other subunits

  • Dynamic Functional Studies:

    • Time-resolved spectroscopy to capture conformational changes during catalysis

    • Single-molecule studies to observe individual proton translocation events

    • These techniques could illuminate the mechanism of energy transduction

  • Comparative Genomics and Evolution:

    • Systematic analysis of nuoK sequences across diverse bacterial species

    • Correlation of sequence variations with ecological niches and metabolic strategies

    • This could reveal how nuoK has adapted to different functional constraints

  • Host-Pathogen Interaction Studies:

    • Investigation of nuoK expression during different stages of infection

    • Analysis of nuoK mutations on L. pneumophila virulence

    • This research could connect energy metabolism to pathogenicity mechanisms

  • Drug Discovery Applications:

    • Structure-based design of inhibitors targeting critical nuoK residues

    • Screening for compounds that specifically disrupt nuoK function

    • This approach could yield new antimicrobial strategies against L. pneumophila

These research directions would significantly advance our understanding of nuoK function and potentially lead to practical applications in combating Legionella infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.