Phosphoserine aminotransferase (serC) catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine in the serine biosynthesis pathway, utilizing pyridoxal 5'-phosphate (PLP) as a cofactor . In Legionella pneumophila, serC is encoded by the serC gene and plays a role in amino acid metabolism, though its direct contribution to virulence remains under investigation . The recombinant form is produced via heterologous expression systems for research and industrial applications .
Enzymatic Engineering: Rational design of serC in E. coli improved substrate specificity for metabolic pathways, such as 1,3-propanediol production, highlighting its adaptability for biotechnological applications .
Structural Insights: While no direct structural data for L. pneumophila serC is available, homology modeling suggests conserved PLP-binding domains critical for catalysis .
Vaccine Development: Recombinant serC is utilized as a vaccine antigen due to its immunogenic potential, though clinical efficacy data specific to L. pneumophila remains limited .
Therapeutic Targets: serC’s role in serine biosynthesis makes it a candidate for antimicrobial strategies targeting L. pneumophila metabolism .
Industrial Biotechnology: Engineered serC variants demonstrate enhanced catalytic efficiency, enabling optimized serine production in synthetic biology platforms .
Pathogenicity Studies: Further research is needed to elucidate serC’s contribution to L. pneumophila virulence and host interaction mechanisms .
KEGG: lpc:LPC_0834
Phosphoserine aminotransferase (serC), also known as Phosphohydroxythreonine aminotransferase (PSAT), is a critical enzyme in the serine biosynthesis pathway of Legionella pneumophila. This enzyme catalyzes the conversion of 3-phosphohydroxypyruvate to L-phosphoserine, which represents an essential step in serine biosynthesis (EC 2.6.1.52) . The serC protein from L. pneumophila subsp. pneumophila (strain Philadelphia 1) consists of 362 amino acids and functions as part of the bacterial metabolic network essential for protein synthesis and various cellular processes . Serine biosynthesis is particularly important for intracellular pathogens like L. pneumophila, as this amino acid serves as a building block for proteins and participates in numerous metabolic reactions required for bacterial survival and replication within host cells. Unlike some virulence factors that directly interact with host machinery, serC primarily supports bacterial metabolism, which indirectly contributes to pathogenesis by enabling L. pneumophila to thrive in restrictive intracellular environments.
The amino acid sequence of L. pneumophila serC reveals important structural features that directly relate to its enzymatic function. The protein contains 362 amino acids with a sequence that includes several conserved domains typical of aminotransferase enzymes . The complete sequence (MNSRVFNFGAGPAMLPEEILKEAQEEFLNWRNTGMSILEIGHRTPEIISLSLSTAEQSLRELLNIPKNYHVLFLGGAARAQFAMIPMNLLRPGDDAAYFIT...) contains regions responsible for pyridoxal phosphate (PLP) binding, which is the essential cofactor for aminotransferase activity . Sequence analysis reveals high conservation in the catalytic core regions across different bacterial species, highlighting their functional importance. The N-terminal region typically contains residues involved in substrate binding, while mid-sequence motifs form the active site where the transamination reaction occurs. The protein's sequence determines its folding pattern, creating the three-dimensional structure necessary for catalyzing the specific conversion of 3-phosphohydroxypyruvate to L-phosphoserine. Conservation of key catalytic residues across different Legionella strains suggests that serC functionality is critical for bacterial viability and cannot tolerate significant sequence variation in functional domains.
Research on virulence-associated proteins in L. pneumophila shows that many are differentially expressed during specific growth phases, particularly during the transition from replicative to transmissive phases. While specific data on serC expression patterns is limited in the provided sources, related research on L. pneumophila proteins suggests that metabolic enzymes like serC are likely differentially regulated during intracellular growth. Studies of SLR-containing proteins in L. pneumophila demonstrate that their expression is upregulated during the transmissive phase within Acanthamoeba castellanii . The transmissive phase is characterized by increased expression of virulence determinants that facilitate bacterial egress and efficient infection spread . Although serC is primarily a metabolic enzyme rather than a classic virulence factor, its expression may follow similar patterns to support bacterial adaptation to changing nutritional environments. The regulation of serC likely involves complex transcriptional networks that respond to nutritional status, stress conditions, and host cell environments, allowing bacteria to adjust amino acid biosynthesis according to availability and requirements during different infection stages.
Escherichia coli represents the most widely used and effective expression system for recombinant L. pneumophila serC protein production . When expressing serC, researchers typically clone the coding sequence into appropriate expression vectors that provide tight regulation of protein production, such as those with inducible promoters. The E. coli expression system offers several advantages for serC production, including rapid growth, high protein yields, and established protocols for protein purification. Based on the product information, recombinant serC has been successfully expressed in E. coli systems, resulting in high purity (>85% by SDS-PAGE) functional protein . For optimal expression, the serC gene can be amplified from L. pneumophila genomic DNA using PCR with specific primers designed to include appropriate restriction sites for cloning into expression vectors. Similar to the cloning approaches used for other L. pneumophila proteins, the purified PCR product can be inserted into vectors using restriction enzyme digestion and ligation or blunt-end cloning methods . Transformation into competent E. coli cells such as TOP10 or BL21(DE3) strains allows for plasmid propagation and protein expression under inducible conditions.
Purification of recombinant serC from L. pneumophila requires a strategic approach to obtain high-purity, active enzyme. Since many recombinant proteins are expressed with affinity tags, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin represents an effective first purification step if serC is expressed with a His-tag. This initial purification can achieve reasonable purity levels (>85% by SDS-PAGE) as observed with commercial preparations . Following IMAC, size exclusion chromatography serves as an excellent polishing step to remove aggregates and contaminants of different molecular weights. For applications requiring higher purity, ion exchange chromatography can further separate serC from remaining contaminants based on charge differences. Throughout the purification process, buffer composition should be optimized to maintain enzyme stability, typically including components such as 20-50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0), 100-300 mM NaCl, and potentially 5-10% glycerol as a stabilizing agent. The addition of reducing agents like 1-5 mM DTT or β-mercaptoethanol may prevent unwanted disulfide bond formation that could affect protein folding and activity. Enzyme activity should be monitored during purification using appropriate spectrophotometric assays that measure the transamination reaction catalyzed by serC.
The stability of recombinant serC depends on several factors including buffer composition, storage temperature, and physical state (liquid vs. lyophilized). According to product specifications, the shelf life of liquid preparations is typically 6 months when stored at -20°C/-80°C, while lyophilized forms maintain stability for approximately 12 months under the same storage conditions . For long-term storage, lyophilization in the presence of cryoprotectants such as trehalose or sucrose is recommended to preserve protein structure during freeze-drying and subsequent reconstitution. Short-term storage in liquid form requires buffer optimization containing stabilizing agents such as 10-20% glycerol to prevent freezing damage and protein denaturation. Protein aliquoting into single-use volumes minimizes freeze-thaw cycles that significantly reduce enzyme activity. Each freeze-thaw cycle potentially decreases activity by 10-30%, making this an important consideration for experimental design. For working solutions, storage at 4°C with protease inhibitors can maintain activity for 1-2 weeks, though regular activity tests should be performed. When using serC for enzymatic assays, activity preservation can be enhanced by adding cofactors such as pyridoxal phosphate (PLP), which is essential for aminotransferase function and stability.
Studying serC function during L. pneumophila infection requires a multi-faceted approach combining genetic manipulation, infection models, and biochemical assays. Gene knockout or knockdown techniques provide the most direct method to assess serC's role in bacterial virulence and metabolism. Researchers can generate serC deletion mutants using established genetic techniques similar to those employed for creating lpnE mutants in L. pneumophila . Complementation studies, where wild-type serC is reintroduced into the mutant strain, are essential to confirm phenotypic changes result specifically from serC deletion rather than polar effects. For in vitro infection studies, researchers should use relevant host cell models including THP-1 derived macrophages and Acanthamoeba castellanii, which represent important human and environmental hosts respectively . Infection protocols typically involve culturing L. pneumophila strains to early stationary phase, infecting host cells at a multiplicity of infection (MOI) of approximately 20, and allowing infection to proceed at 35°C . After infection, non-adherent bacteria are removed by washing with PBS, and extracellular bacteria are killed with gentamicin treatment (100 μg/mL for 1 hour) . Intracellular bacterial replication can then be quantified at various time points by lysing host cells and plating serial dilutions on BCYE agar to enumerate colony-forming units.
Several established models provide valuable systems for investigating serC's role in L. pneumophila pathogenesis. THP-1 human monocytic cells differentiated into macrophage-like cells represent an excellent in vitro model for studying L. pneumophila infection in human hosts . These cells can be maintained in RPMI 1640 medium supplemented with 10% calf serum and differentiated using phorbol 12-myristate 13-acetate treatments . A549 alveolar epithelial cells provide another relevant human cell model that has been successfully used in L. pneumophila invasion studies . For environmental host modeling, Acanthamoeba castellanii serves as a natural host for L. pneumophila and can be maintained in PYG medium during infection experiments . These amoebae not only represent environmental reservoirs but also share infection mechanisms with human macrophages. For in vivo studies, the A/J mouse strain provides a well-established animal model for L. pneumophila infection . A/J mice are permissive to L. pneumophila replication and develop pulmonary infection similar to human Legionnaires' disease. In these animal models, bacterial burdens in lungs can be quantified at different time points post-infection, and competitive index assays comparing wild-type and serC mutant strains can quantify the contribution of serC to in vivo fitness and virulence .
The impact of serC on L. pneumophila intracellular trafficking can be assessed using established immunofluorescence and microscopy techniques similar to those used for studying other L. pneumophila proteins. Researchers can track the association of bacterial vacuoles with endosomal/lysosomal markers such as LAMP-1, which indicates fusion with late endosomes . These studies involve infecting host cells (THP-1 macrophages or A549 cells) with wild-type L. pneumophila and serC mutants, then fixing cells at specific time points post-infection (commonly 5 hours) . Immunofluorescence staining using antibodies against bacterial markers and cellular compartment markers (like LAMP-1) allows visualization of bacterial trafficking. Quantification involves calculating the percentage of bacterial vacuoles that avoid LAMP-1 association, which indicates successful modulation of host trafficking pathways . Confocal microscopy provides high-resolution images to assess colocalization between bacteria and host markers. Live-cell imaging using fluorescently tagged proteins can further reveal dynamic interactions during infection. For more detailed analysis, electron microscopy can be employed to examine ultrastructural features of the L. pneumophila-containing vacuole. Complementation experiments, where the serC mutation is complemented with plasmid-expressed wild-type serC, confirm that observed trafficking defects are specifically due to serC disruption rather than secondary mutations or polar effects.
The interaction between bacterial serC and host cell metabolic pathways represents a sophisticated aspect of L. pneumophila pathogenesis that remains incompletely characterized. As an aminotransferase involved in serine biosynthesis, serC potentially intersects with host amino acid metabolism during intracellular replication. Legionella species manipulate host cell processes through multiple strategies, including the secretion of effector proteins that interact with host machinery . While serC itself has not been identified as a secreted effector in the provided literature, its metabolic function may indirectly influence host-pathogen metabolic exchange. Research on L. pneumophila serogroup 1 has demonstrated that bacterial components can interact with eukaryotic cell surface receptors, mediating bacterial attachment and invasion . Investigating whether serC impacts these interactions would require advanced metabolomics approaches comparing amino acid pools in host cells infected with wild-type versus serC-deficient L. pneumophila. Stable isotope labeling experiments using 13C or 15N-labeled precursors could track the flow of metabolites between bacterial and host pathways. Transcriptomic and proteomic analyses of infected host cells could reveal whether serC deficiency triggers compensatory changes in host metabolism. Such studies would provide valuable insights into how bacterial metabolic enzymes like serC contribute to establishing a replicative niche within host cells.
L. pneumophila encounters diverse environmental conditions during its lifecycle, transitioning between extracellular environments, protozoan hosts like Acanthamoeba castellanii, and human macrophages . The role of serC in adapting to these varied conditions likely involves modulating amino acid metabolism to match resource availability. Studies have shown that L. pneumophila proteins, particularly those involved in virulence, are differentially expressed during the transmissive phase within A. castellanii . This phase is characterized by upregulation of factors that facilitate bacterial egress and infection spread . As a metabolic enzyme, serC may show similar expression patterns to support adaptation to changing nutritional landscapes. Experimental approaches to investigate this would include transcriptomic and proteomic analyses comparing serC expression across different growth conditions and host cell types. Researchers could use qRT-PCR to quantify serC expression during growth in laboratory media versus intracellular replication in different host cells. Metabolic labeling experiments would help track serine biosynthesis rates in different environments. Additionally, phenotypic characterization of serC mutants growing under nutrient-limited conditions versus nutrient-rich conditions could reveal environment-specific requirements for this enzyme. Such studies would enhance our understanding of how metabolic adaptability contributes to L. pneumophila's success as an environmental pathogen capable of infecting diverse hosts.
The essential metabolic function of serC makes it a potentially attractive target for novel antimicrobial development against L. pneumophila. Targeting bacterial-specific metabolic pathways offers opportunities for selective toxicity, reducing potential side effects on host cells. Evaluating serC as a drug target would require comprehensive validation studies beginning with confirmation of its essentiality through conditional knockout systems or CRISPRi approaches, since complete deletion might not be viable if serC is essential. High-throughput screening of chemical libraries against purified recombinant serC could identify potential inhibitory compounds that specifically target the bacterial enzyme without affecting human homologs. Structure-based drug design approaches would benefit from solving the crystal structure of L. pneumophila serC, enabling rational design of inhibitors targeting catalytic sites or protein-specific pockets. Lead compounds identified through screening would require rigorous testing in cellular infection models using THP-1 macrophages and A. castellanii . Promising candidates would then progress to animal models such as A/J mice . The ideal serC inhibitor would demonstrate selective inhibition of bacterial growth with minimal toxicity to host cells, favorable pharmacokinetic properties, and efficacy in reducing bacterial burden in animal infection models. This research direction could potentially yield new therapeutic options for treating Legionnaires' disease, particularly for strains resistant to current antibiotics.
Establishing optimal assay conditions for recombinant L. pneumophila serC requires careful consideration of multiple parameters to ensure reliable enzyme activity measurements. The standard assay for phosphoserine aminotransferase activity typically measures the conversion of 3-phosphohydroxypyruvate to L-phosphoserine in the presence of glutamate as the amino donor. The assay buffer composition significantly impacts enzyme performance, with optimal conditions typically including 50 mM HEPES or Tris buffer (pH 7.5-8.0), 5-10 mM MgCl2 as a cofactor, and 1-2 mM DTT as a reducing agent to maintain cysteine residues in their reduced state. The reaction requires pyridoxal phosphate (PLP) as an essential cofactor, typically added at 0.1-0.5 mM concentration. Temperature optimization is crucial, with most researchers conducting assays at 30-37°C to mimic physiological conditions relevant to L. pneumophila infection. Substrate concentrations should be optimized through Michaelis-Menten kinetics analysis, typically starting with 0.1-2 mM 3-phosphohydroxypyruvate and 1-10 mM glutamate. Activity can be monitored spectrophotometrically by coupling the reaction to additional enzymes that produce detectable signals, or through direct measurement of product formation using HPLC or mass spectrometry. Researchers should also evaluate potential inhibitors or activators in the reaction mixture and determine the linear range of the assay with respect to enzyme concentration and time.
Investigating protein-protein interactions involving L. pneumophila serC requires multiple complementary approaches to identify and validate interaction partners. The yeast two-hybrid system represents an established method for screening potential interactions, similar to the approach used to identify interactions between L. pneumophila LpnE and host proteins . This technique involves creating fusion constructs of serC with DNA-binding domains and screening against libraries of prey proteins, particularly those from host cells like HeLa cell cDNA libraries . Co-immunoprecipitation experiments using antibodies against tagged versions of serC can pull down interacting proteins from bacterial lysates or infected host cell lysates, with subsequent mass spectrometry identification of binding partners. Pull-down assays using purified recombinant serC immobilized on appropriate resins provide another approach for identifying direct binding partners. For validating and characterizing specific interactions, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding affinities and thermodynamic parameters. Microscopy-based techniques including Förster Resonance Energy Transfer (FRET) or Proximity Ligation Assay (PLA) can confirm interactions in cellular contexts. Crosslinking mass spectrometry identifies interaction interfaces by covalently linking proteins in close proximity. These approaches could reveal whether serC participates in metabolic complexes with other enzymes or unexpectedly interacts with host proteins during infection, potentially identifying novel functions beyond its canonical metabolic role.