Recombinant Legionella pneumophila Probable intracellular septation protein A (LPC_0717)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; LPC_0717; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Legionella pneumophila (strain Corby)
Target Names
LPC_0717
Target Protein Sequence
MKLLFDFFPIVLFFIVYKFFGIYTATAVAMVASLTQVAFYRLKFQHYEKMHLFSLAIIMV LGGATLFFQNPWFIKWKPTGIYWLSALVFYGSGYIGSKPLIQKMMEANINLTTKIWYRLN LAWTLFFIVMGALNLYVAYHYDTDVWVNFKLFGGVGFTLLFVLIQAFYLTKHTDEKSFEK Q
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: lpc:LPC_0717

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Legionella pneumophila and how does it cause disease?

Legionella pneumophila is a facultative intracellular parasite ubiquitous in freshwater environments, where it replicates in biofilms and within protozoan hosts such as amoebae and ciliates . Following aerosol transmission into the human respiratory tract, L. pneumophila replicates inside human alveolar macrophages, causing a severe pneumonia known as Legionnaires' disease . The bacterium requires the Dot/Icm Type IV secretion system to deliver hundreds of bacterial proteins to the host cytosol, which manipulate cellular processes to establish a protected compartment for bacterial replication known as the Legionella-containing vacuole . Importantly, L. pneumophila is not typically transmitted from person to person; the CDC has only one recorded case of Legionnaires' disease from person-to-person contact . Infection primarily occurs when individuals breathe in water vapor containing the bacteria in the immediate vicinity of that vapor.

What is the biological function of the LPC_0717 protein in Legionella pneumophila?

The LPC_0717 protein is characterized as a probable intracellular septation protein A in Legionella pneumophila . While specific research on LPC_0717 is limited in the available literature, septation proteins typically play crucial roles in bacterial cell division processes. As an intracellular septation protein, LPC_0717 likely participates in the formation of the septum during cell division, a critical process for bacterial reproduction and survival within host cells. The protein may be part of the complex machinery that facilitates bacterial replication within the specialized Legionella-containing vacuole. Given L. pneumophila's sophisticated intracellular lifestyle, LPC_0717 potentially contributes to the bacterium's ability to evade host defenses, acquire nutrients, and maintain its replicative niche within macrophages and amoebae.

How does LPC_0717 compare to other intracellular bacterial septation proteins?

While the search results don't provide direct comparisons between LPC_0717 and other bacterial septation proteins, we can infer some relationships based on general bacterial cell division mechanisms. Septation proteins across different bacterial species often share conserved domains and functional similarities despite sequence variations. In many bacteria, septation involves the FtsZ protein forming a ring structure at the division site, followed by recruitment of other proteins including septation-specific proteins. The designation of LPC_0717 as a "probable" septation protein suggests that its function has been inferred through sequence homology or structural predictions rather than direct experimental validation. Researchers should consider comparative genomic approaches to identify homologs in other intracellular pathogens, which could provide insights into conserved mechanisms of intracellular bacterial division and potential targets for broad-spectrum antimicrobial development.

What purification strategies yield the highest quality recombinant LPC_0717?

While specific purification protocols for LPC_0717 are not detailed in the search results, general approaches for recombinant bacterial proteins can be applied. A multi-step purification strategy typically begins with affinity chromatography using a fusion tag (His-tag, GST, etc.) incorporated into the recombinant construct. Following initial capture, researchers should implement secondary purification steps such as ion exchange chromatography or size exclusion chromatography to remove contaminants and aggregates. Quality assessment should include SDS-PAGE analysis for purity, Western blotting for identity confirmation, and dynamic light scattering to evaluate protein homogeneity. For structural studies, researchers should also verify proper folding using circular dichroism spectroscopy. Optimization of buffer conditions is critical, with typical buffers containing 20-50 mM Tris or phosphate at pH 7-8, 100-300 mM NaCl, and potentially glycerol or reducing agents to maintain stability.

How can researchers verify the functional activity of purified recombinant LPC_0717?

Verifying functional activity of recombinant LPC_0717 requires development of appropriate biochemical and cellular assays. Since LPC_0717 is described as a probable intracellular septation protein, researchers should consider assays that assess protein-protein interactions with other components of the bacterial division machinery. Pull-down assays, bacterial two-hybrid systems, or surface plasmon resonance can help identify interaction partners. Additionally, researchers can develop in vitro septation assays using purified components of the division machinery to assess whether LPC_0717 affects aspects like FtsZ polymerization or septum formation. For cellular approaches, complementation studies in LPC_0717 knockout strains of L. pneumophila could reveal whether the recombinant protein restores normal cell division patterns. Microscopy techniques, including super-resolution methods, can be employed to visualize the localization of fluorescently tagged LPC_0717 during different stages of bacterial cell division.

How might LPC_0717 contribute to L. pneumophila survival within host cells?

The contribution of LPC_0717 to L. pneumophila intracellular survival likely extends beyond its presumed role in bacterial cell division. L. pneumophila requires sophisticated mechanisms to establish its replicative niche within macrophages and amoebae, including the Dot/Icm Type IV secretion system that delivers hundreds of bacterial effector proteins to manipulate host cellular processes . While the search results don't directly address LPC_0717's role in this context, septation proteins could potentially influence bacterial adaptation to the intracellular environment. Research approaches to investigate this question could include creating conditional LPC_0717 mutants and assessing their ability to replicate within host cells under various conditions. Researchers might also explore whether LPC_0717 expression is regulated in response to intracellular cues, similar to how other L. pneumophila genes respond to factors like iron limitation or oxidative stress . Transcriptomic and proteomic analyses comparing intracellular versus extracellular bacteria could reveal whether LPC_0717 expression changes during infection.

What are the structural characteristics of LPC_0717 and how do they relate to its function?

Detailed structural information about LPC_0717 is not provided in the search results, presenting an opportunity for significant research contribution. To elucidate the structure-function relationship of this protein, researchers should consider employing X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy to determine its three-dimensional structure. Computational approaches including homology modeling can provide preliminary structural insights if homologous proteins with known structures exist. Structural analysis should focus on identifying conserved domains, potential active sites, and regions involved in protein-protein interactions. Site-directed mutagenesis experiments targeting key structural features can help validate their functional significance. Researchers should also investigate whether LPC_0717 undergoes conformational changes during the cell division cycle or in response to environmental cues encountered within host cells.

How does LPC_0717 interact with other components of the L. pneumophila cell division machinery?

Understanding how LPC_0717 interacts with other components of the L. pneumophila cell division machinery represents a significant research opportunity. Researchers should first identify potential interaction partners through approaches such as co-immunoprecipitation coupled with mass spectrometry or bacterial two-hybrid screening. Verification of interactions can be accomplished through techniques like bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) in live bacteria. Time-lapse microscopy using fluorescently tagged proteins can reveal the temporal sequence of protein recruitment to the division site and how LPC_0717 fits into this process. Researchers should also consider whether LPC_0717 interacts with unique components of the L. pneumophila division machinery that might distinguish it from model organisms like E. coli. Comparative studies with other intracellular pathogens could highlight conserved and divergent aspects of septation protein function in bacteria adapted to intracellular lifestyles.

What are the best approaches for studying LPC_0717 function in the context of infection models?

Studying LPC_0717 function in infection models requires careful experimental design to capture its role in the complex host-pathogen interaction. Researchers should develop genetically tractable L. pneumophila strains with modifications to LPC_0717, including clean deletions, conditional expression systems, and fluorescent protein fusions. Infection models should include both cell culture systems (human macrophages and amoebae) and when appropriate, animal models that recapitulate aspects of Legionnaires' disease. The research by Edelstein et al. demonstrated that transposon insertion sequencing combined with defined mutant sublibraries can effectively identify L. pneumophila fitness determinants in primary mouse macrophages and the mouse lung . This approach could be adapted to specifically investigate LPC_0717 function. When designing experiments, researchers should consider the timing of observations, as L. pneumophila undergoes distinct phases during intracellular replication that might influence LPC_0717 activity or requirement.

How can researchers overcome challenges in generating LPC_0717 knockout or knockdown strains?

Generating genetic modifications in L. pneumophila presents specific challenges that researchers must address when targeting LPC_0717. If LPC_0717 is essential for bacterial viability, traditional knockout approaches may fail to produce viable mutants. In such cases, researchers should consider conditional expression systems, such as inducible promoters or degradation tag systems, that allow controlled depletion of the protein. The allelic exchange methodology described for S. flexneri in the search results provides a template that can be adapted for L. pneumophila . Researchers should design constructs with homology arms flanking the LPC_0717 gene and incorporate appropriate antibiotic resistance markers for selection. CRISPR-Cas9 systems optimized for L. pneumophila offer an alternative approach for precise genome editing. For phenotypic characterization, researchers should assess both extracellular growth in standard and stress conditions (such as iron limitation) and intracellular replication within relevant host cells.

What control experiments are essential when evaluating the effects of LPC_0717 mutations on bacterial physiology?

When evaluating the effects of LPC_0717 mutations on L. pneumophila physiology, a comprehensive set of control experiments is essential to ensure valid interpretation of results. Genetic complementation represents the gold standard control, where the wild-type LPC_0717 gene is reintroduced to confirm that observed phenotypes are specifically due to its absence. The complementation approach used for tatB mutants described in the search results provides a useful model . Researchers should also include controls for potential polar effects on neighboring genes by measuring their expression in the mutant background. When assessing growth phenotypes, controls should include testing under various nutritional conditions, as exemplified by the tatB mutants that exhibited normal growth in standard media but grew slowly under low-iron conditions . For infection studies, researchers should control for general bacterial fitness by comparing growth in laboratory media versus intracellular replication rates. Additionally, experimental designs should incorporate appropriate time points to capture potential temporal dynamics in phenotypic manifestations.

Comparison of Expression Systems for Recombinant LPC_0717 Production

Expression SystemAdvantagesLimitationsOptimal ConditionsTypical Yield
E. coliRapid growth, high yields, cost-effective, well-established protocolsLimited post-translational modifications, potential inclusion body formation37°C, IPTG induction (0.1-1.0 mM), 4-6 hours post-induction10-50 mg/L
Yeast (S. cerevisiae/P. pastoris)Eukaryotic post-translational modifications, secretion capabilityLonger cultivation time, complex media requirements30°C, methanol induction for P. pastoris, 3-5 days5-20 mg/L
Baculovirus/Insect CellsComplex eukaryotic modifications, proper folding of complex proteinsHigher cost, specialized expertise required27°C, high MOI infection, harvest 48-72 hours post-infection1-10 mg/L
Mammalian CellsMost authentic post-translational modificationsHighest cost, lowest yields, longest production time37°C, 5% CO₂, transient or stable transfection, 3-7 days0.1-5 mg/L

The selection of an expression system for recombinant LPC_0717 should be guided by the specific research objectives and downstream applications. For structural studies requiring large protein quantities, E. coli systems typically offer the most practical approach despite potential limitations in post-translational modifications. For functional studies where authentic protein conformation is critical, eukaryotic expression systems may be preferable despite their reduced yields and increased complexity. Researchers should conduct small-scale expression trials in multiple systems when resources permit to determine the optimal approach for their specific requirements.

Methodological Approaches for Studying LPC_0717 Function

Experimental ApproachApplicationsAdvantagesLimitationsKey Controls
Gene Knockout/KnockdownEssential function determinationDirect assessment of gene requirementLethal if essential, potential polar effectsComplementation, growth curves in multiple media
Fluorescent Protein FusionLocalization studiesVisualization in live cells, temporal dynamicsPotential interference with functionNon-fused fluorescent protein control, C and N-terminal fusions
Bacterial Two-HybridProtein interaction screeningComprehensive, suitable for membrane proteinsFalse positives/negativesEmpty vector controls, known interaction pairs
Co-immunoprecipitationVerification of protein complexesDetects native interactionsRequires specific antibodies or tagsIgG controls, reverse co-IP
TranscriptomicsGlobal response to mutationComprehensive, unbiasedIndirect functional assessmentWild-type comparison, multiple growth conditions
Infection ModelsRole during host interactionPhysiologically relevantComplex, multiple variablesComplemented strains, multiple host cell types

Researchers investigating LPC_0717 function should employ multiple complementary approaches to build a comprehensive understanding of its role. The integration of genetic, biochemical, and cellular techniques provides the most robust framework for characterizing bacterial proteins with complex functions. Particular attention should be paid to the context of experiments, as L. pneumophila proteins may function differently during various phases of its lifecycle or under different environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.