Recombinant Legionella pneumophila Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Legionella pneumophila Prolipoprotein Diacylglyceryl Transferase (Lgt)

Recombinant Legionella pneumophila Prolipoprotein diacylglyceryl transferase (Lgt) is a recombinant protein engineered to catalyze the first step in bacterial lipoprotein biogenesis. It transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in prolipoproteins, a process critical for membrane protein maturation in Gram-negative bacteria . The recombinant form is produced via heterologous expression systems (e.g., E. coli, yeast, or baculovirus) and is used in structural, functional, and vaccine-related research .

Membrane Topology

Lgt is a multispanning membrane protein with a periplasmic catalytic domain. Structural studies in E. coli reveal a topology involving transmembrane helices and conserved residues (e.g., R143 and G154) essential for phospholipid binding and catalysis .

Enzymatic Activity

Lgt facilitates the transfer of a diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming mature lipoproteins. This reaction is indispensable for bacterial viability, as lipoproteins perform roles in cell division, signal transduction, and nutrient acquisition .

Production and Applications

ParameterDetails
Expression HostsE. coli, yeast, baculovirus, or mammalian cells
PurityTypically >95% (via chromatography or affinity purification)
Storage BufferTris-based buffer with 50% glycerol (pH 7.4–8.0)
Storage Conditions-20°C (stable for months); avoid repeated freeze-thaw cycles
ApplicationsStructural studies, vaccine development, inhibitor screening

Recombinant Lgt is commercialized as a research reagent for studying bacterial membrane protein biogenesis and as a potential target for antibiotic development .

Functional Studies

  • Essentiality: Lgt is indispensable in Gram-negative bacteria, as lipoproteins are required for membrane integrity and virulence .

  • Inhibitor Discovery: Macrocyclic peptides (e.g., G2824) inhibit E. coli Lgt by disrupting substrate binding .

Vaccine-Related Research

  • Immune Targets: Recombinant Lgt from L. pneumophila strain Paris is explored as a vaccine candidate to elicit protective immunity .

Comparative Analysis of Lgt Across Bacterial Species

SpeciesGeneKey Features
L. pneumophilalgtStrain-specific variations (e.g., Corby vs. Paris); critical for virulence
E. colilgtMultispanning topology; conserved residues for catalysis
Bacillus subtilislgtParalogs identified, but functional redundancy unclear

Challenges and Future Directions

  • Production Challenges: Low yield in heterologous systems and instability require optimized expression protocols .

  • Therapeutic Potential: Inhibiting Lgt could disrupt bacterial membrane protein biogenesis, offering a novel antibiotic strategy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
lgt; LPC_3155; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Legionella pneumophila (strain Corby)
Target Names
lgt
Target Protein Sequence
MLTYPNINPIAFSFGPLKVHWYGLMYLIGFIGAWLLGYWRIKHYKLNWNNDQLSDLIFYS ALGVILGGRVGYMLFYDFQEFIHHPWVLFKIWEGGMSFHGGLLGVVIAAWLFCRKYGKTF LEVGDFVAPLVPLGLAAGRLGNFINGELWGRATDVPWGMIYPHVDDQPRHPSQLYEFGLE GVALFILIWCYASKPRQQGRVSALFLMGYAICRLIAESFRQPDSQLGFVAFGWLTMGQVL SIPMLLIGIWLWWAKR
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links

KEGG: lpc:LPC_3155

Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the catalytic function of Lgt in bacterial lipoprotein processing?

Lgt (Lipoprotein diacylglyceryl transferase) catalyzes the first critical lipid-posttranslational modification in the bacterial lipoprotein pathway, converting preprolipoprotein (ppBLP) to prolipoprotein (pBLP) . The enzyme recognizes and binds the signal peptide of an incoming ppBLP substrate and forms a thioether link between the thiol group on the invariant lipobox cysteine and a diacylglyceryl moiety from a lipid substrate, primarily phosphatidylglycerol (PG) . This reaction produces a prolipoprotein that becomes doubly anchored in the cytoplasmic membrane through its signal peptide and the two fatty acyl chains in the diacylglyceryl moiety . The enzyme's catalytic function is essential in Gram-negative bacteria and often required for virulence in Gram-positive species, highlighting its significance as a target for antimicrobial development .

How does the catalytic mechanism of Lgt function at the molecular level?

The catalytic mechanism of Lgt revolves around a highly conserved His103-Gly-Gly-Leu106 motif found in the side cleft between major and minor transmembrane helix domains in Escherichia coli Lgt . His103 functions as the catalytic residue, abstracting a proton from the thiol group of the lipobox cysteine on the ppBLP substrate to generate a reactive thiolate . This nucleophile then attacks the lipid substrate at the ester bond between the phosphate and diacylglyceryl moiety, producing pBLP and glycerol-1-phosphate as products . Notably, recent research has demonstrated that Lgt from E. coli can use PG containing racemic terminal glycerol at C2 as a substrate, allowing the enzyme to produce both glycerol-1-phosphate and glycerol-3-phosphate as products . This characteristic has been leveraged to develop a luciferase-coupled assay for monitoring Lgt activity .

How does Lgt from Legionella pneumophila differ from other bacterial Lgt enzymes?

When discussing Legionella pneumophila, it's important to distinguish between two different proteins abbreviated as "Lgt": the prolipoprotein diacylglyceryl transferase involved in bacterial lipoprotein processing, and a family of cytotoxic glucosyltransferases . The latter forms three subfamilies (Lgt1-3) that function as virulence factors by glucosylating the mammalian elongation factor eEF1A at serine-53, inhibiting protein synthesis in host cells and subsequently causing cell death . Expression studies have revealed differential regulation of these glucosyltransferases, with Lgt1 reaching maximum production during stationary phase in broth culture or late phase of host-cell interaction, while Lgt3 peaks during lag phase of liquid culture and early stages of bacterium-amoeba interaction . This distinct expression pattern suggests specialized roles for each glucosyltransferase during different phases of Legionella infection.

What expression systems are most effective for producing recombinant Legionella pneumophila Lgt?

For recombinant expression of Legionella pneumophila Lgt, several methodological approaches can be implemented. Based on research with similar bacterial recombinases, RSF1010-based shuttle plasmids under ptac control have proven effective for expressing recombinant proteins in E. coli . When designing an expression system, it's crucial to consider the membrane-associated nature of Lgt, which typically contains multiple transmembrane helices . For successful expression, researchers should optimize codon usage for the host system, incorporate appropriate solubilization tags or fusion partners if membrane extraction is needed, and carefully control induction parameters. Expression in the native Legionella pneumophila is possible through unmarked gene deletion techniques using Flp recombination as demonstrated with other proteins, which allows for genomic integration and expression under native regulatory elements .

What purification strategy yields the highest activity for recombinant Lgt?

Purification of recombinant Lgt requires careful consideration of its membrane-associated nature and lipid requirements for activity. A methodological approach should include gentle solubilization using detergents that maintain the enzyme's native conformation while extracting it from the membrane environment. Based on structural studies of Lgt, purification should maintain the integrity of the transmembrane domains and the catalytic His103-containing motif . Affinity chromatography with histidine or other tags positioned to avoid interference with the catalytic domain often provides the best initial purification step. For highest activity retention, incorporate phosphatidylglycerol (PG) or similar lipids in the purification buffers as Lgt preferentially utilizes PG as a substrate . Activity measurements using the luciferase-coupled assay that detects glycerol-phosphate production can verify that the purified enzyme maintains its catalytic function throughout the purification process .

How can researchers verify proper folding and activity of recombinant Lgt after purification?

Verification of proper folding and activity of recombinant Lgt requires multiple complementary approaches. The primary methodology involves a functional assay measuring the diacylglyceryl transferase activity. The luciferase-coupled assay mentioned in recent literature detects glycerol-phosphate production as Lgt transfers the diacylglyceryl moiety to the preprolipoprotein substrate . Structurally, circular dichroism spectroscopy can assess secondary structure content, particularly important for confirming the alpha-helical transmembrane domains characteristic of Lgt . Additionally, researchers should employ thermal shift assays to evaluate protein stability and proper folding. For more detailed structural analysis, limited proteolysis experiments can determine whether the recombinant protein exhibits the expected digestion pattern of a properly folded enzyme. When assessing activity, it's essential to include positive controls with known Lgt substrates containing the conserved lipobox motif and the critical cysteine residue that accepts the diacylglyceryl modification .

What are the established assays for measuring Lgt enzymatic activity in vitro?

Several methodological approaches exist for measuring Lgt enzymatic activity. A recently developed luciferase-coupled assay exploits the ability of E. coli Lgt to use PG with racemic terminal glycerol, producing glycerol-1-phosphate and glycerol-3-phosphate . This assay couples the release of glycerol-phosphate to light production, providing a sensitive and real-time measurement of enzyme activity. Alternative methods include radiolabeled substrate incorporation assays, where researchers can track the transfer of labeled diacylglyceryl moieties from phospholipid donors to peptide substrates containing the lipobox motif. When establishing an in vitro assay, researchers must carefully consider the detergent and lipid composition of the reaction mixture, as these components significantly impact enzyme stability and activity . Additionally, assay conditions should mimic the physiological environment of Lgt, including appropriate pH (typically near neutral), salt concentration, and temperature conditions that support optimal enzymatic function while maintaining protein stability.

How can researchers design substrate specificity experiments for Lgt?

Designing substrate specificity experiments for Lgt requires systematic variation of both the lipid donor and protein acceptor substrates. For the lipid substrate, researchers should test various phospholipids beyond the preferred phosphatidylglycerol (PG), including phosphatidylethanolamine, phosphatidylcholine, and cardiolipin at different concentrations . Synthetic lipid analogs with modified head groups or acyl chain compositions can further probe structural requirements for substrate recognition. For protein substrates, synthetic peptides containing variations of the lipobox sequence (typically Leu-X-X-Cys) with systematic amino acid substitutions will reveal the sequence constraints for substrate recognition . Mass spectrometry analysis of reaction products provides definitive evidence of modification, while comparative kinetic analysis (measuring Km and kcat values) quantifies the relative efficiency with which Lgt processes different substrates. Control experiments should include substrates lacking the critical cysteine residue or with pre-modified cysteine to confirm specificity .

What methodologies can identify potential inhibitors of Lgt activity?

Identifying potential inhibitors of Lgt requires a multi-faceted screening approach. High-throughput screening can utilize the luciferase-coupled assay that detects glycerol-phosphate production during Lgt catalysis to rapidly evaluate compound libraries . Structure-based virtual screening represents another powerful methodology, leveraging the available structural information about Lgt's catalytic site, particularly the His103-containing motif critical for activity . Researchers should develop counterscreens to eliminate compounds that interfere with the assay rather than Lgt itself. For validation of hits, orthogonal assays using different detection methods should confirm inhibition. Mechanistic studies can determine whether compounds act competitively with the ppBLP substrate, the phospholipid substrate, or through allosteric mechanisms. Given Lgt's essential role in Gram-negative bacteria, researchers should evaluate promising inhibitors for antimicrobial activity against whole cells, examining growth inhibition, membrane integrity, and accumulation of unprocessed prelipoproteins .

How can researchers utilize site-directed mutagenesis to investigate Lgt catalytic mechanisms?

Site-directed mutagenesis provides a powerful methodology for investigating Lgt's catalytic mechanism. Researchers should prioritize mutations of the highly conserved His103-Gly-Gly-Leu106 motif, particularly focusing on His103, which previous studies have shown to be essential for catalytic activity . Substituting His103 with asparagine or glutamine, as demonstrated in previous research, can confirm its role in proton abstraction from the thiol of the lipobox cysteine . Additional mutations should target residues that potentially coordinate the phosphatidylglycerol substrate or form the binding pocket for the preprolipoprotein substrate. Alanine-scanning mutagenesis of conserved residues lining the side cleft between major and minor transmembrane helix domains can identify amino acids essential for substrate binding versus catalysis. For each mutant, researchers should perform detailed kinetic analysis, comparing Km values (substrate affinity) and kcat values (catalytic rate) with wild-type enzyme to distinguish between effects on binding versus catalysis .

What strategies can be employed to crystallize membrane-bound Lgt for structural studies?

Crystallizing membrane-bound proteins like Lgt presents significant challenges requiring specialized methodologies. Based on the successful crystallization of other membrane proteins, researchers should consider the following approaches: (1) Use of lipidic cubic phase (LCP) crystallization, which provides a membrane-mimetic environment suitable for integral membrane proteins; (2) Incorporation of fusion partners like T4 lysozyme or BRIL (apocytochrome b562RIL) to increase the hydrophilic surface area available for crystal contacts; and (3) Screening detergents systematically to identify those that maintain Lgt stability while allowing crystal formation . Nanobodies or antibody fragments that bind specifically to Lgt can also facilitate crystallization by stabilizing flexible regions. For data collection, microcrystallography at synchrotron radiation sources or X-ray free-electron lasers may be necessary for smaller crystals. Structure determination might benefit from molecular replacement using the existing E. coli Lgt structure (PDB code 5AZB) as a search model, though researchers should be prepared for significant conformational differences between orthologs .

How does Lgt contribute to Legionella pneumophila pathogenesis compared to the Lgt1-3 glucosyltransferases?

The relationship between Lgt (prolipoprotein diacylglyceryl transferase) and the Lgt1-3 family of glucosyltransferases in Legionella pneumophila pathogenesis represents an intriguing research question requiring careful experimental design. While these proteins share an abbreviation, they have distinct functions: Lgt processes bacterial lipoproteins, while Lgt1-3 directly modify host proteins . To investigate their relative contributions to pathogenesis, researchers should generate isogenic mutants lacking either Lgt or members of the Lgt1-3 family, then compare their ability to replicate within host cells using fluorescence microscopy and colony-forming unit enumeration. Differential gene expression analysis during various stages of infection can reveal temporal patterns, as research shows Lgt1 expression peaks during stationary phase or late infection, while Lgt3 is maximal during lag phase or early infection stages . Researchers should also analyze the virulence of these mutants in relevant animal models, measuring bacterial burden, inflammatory responses, and host survival. Complementation experiments with wild-type genes would confirm phenotypes are specifically due to the targeted mutations .

What are common challenges in expressing recombinant Lgt and how can they be overcome?

Expression of recombinant Lgt often encounters several challenges due to its membrane-associated nature. Toxicity to host cells represents a common issue, as overexpression of membrane proteins can disrupt membrane integrity. Researchers can address this by using tightly regulated expression systems with tunable induction, such as the ptac control system used successfully for other recombinant proteins in Legionella . Protein misfolding frequently occurs with membrane proteins expressed in heterologous systems; this can be mitigated by lowering cultivation temperature (typically to 16-25°C), adding chemical chaperones like glycerol or betaine to the growth medium, or co-expressing molecular chaperones. Poor yield often results from codon usage differences between Legionella pneumophila and the expression host; researchers should optimize codons for the expression host or use specialized strains with expanded tRNA pools. For extraction, traditional detergent-based methods may disrupt protein structure; gentler approaches using nanodisc technology or styrene-maleic acid lipid particles (SMALPs) can extract Lgt within its native lipid environment, preserving structural integrity and activity .

How can researchers differentiate between the functions of Lgt and the Lgt1-3 glucosyltransferases in experimental settings?

Differentiating between the functions of Lgt (prolipoprotein diacylglyceryl transferase) and Lgt1-3 (cytotoxic glucosyltransferases) requires methodological precision in experimental design. Substrate specificity assays provide the clearest distinction: Lgt transfers diacylglyceryl moieties to preprolipoprotein substrates containing the lipobox motif, while Lgt1-3 glucosylate mammalian elongation factor eEF1A specifically at serine-53 . Researchers can use purified recombinant proteins with their respective substrates and measure the distinct reaction products: diacylglyceryl-modified proteins for Lgt versus glucosylated eEF1A for Lgt1-3. Expression pattern analysis during bacterial growth and host cell infection represents another differentiating method, as Lgt1 shows maximal expression during stationary phase or late infection, while Lgt3 peaks during lag phase or early infection . RT-PCR using gene-specific primers can track transcript levels, while Western blotting with specific antibodies can monitor protein production during various growth phases . Genetic complementation experiments using mutants deficient in either Lgt or Lgt1-3 family members would confirm the distinct phenotypes associated with each protein family .

What emerging technologies might advance our understanding of Lgt structure and function in the next five years?

Several emerging technologies promise to significantly advance our understanding of Lgt structure and function. Cryo-electron microscopy (cryo-EM) is rapidly evolving to determine structures of smaller membrane proteins and may soon enable visualization of Lgt in various conformational states during catalysis. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map dynamic regions of the protein and identify conformational changes upon substrate binding without requiring crystallization. Native mass spectrometry techniques are increasingly capable of analyzing membrane proteins within nanodiscs or detergent micelles, potentially revealing details of Lgt-substrate interactions and complex formation. AlphaFold and related machine learning approaches will likely provide increasingly accurate structural predictions of Lgt variants and their interactions with substrates. Single-molecule fluorescence resonance energy transfer (smFRET) could track conformational changes during the catalytic cycle in real-time. CRISPR-based transcriptional regulation technologies may enable precise temporal control of Lgt expression in bacteria, allowing detailed investigation of its essentiality at different growth stages. Optogenetic tools adapted for bacterial systems might permit spatiotemporal control of Lgt activity, revealing its localization-dependent functions within bacterial cells .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.