Recombinant Legionella pneumophila subsp. pneumophila ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock
Cat. No.
BT2056402
Source
in vitro E.coli expression system
Synonyms
atpB; lpg1051; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Quick Inquiry

Description

Functional Role in L. pneumophila Pathogenesis

ATP synthase subunit a is integral to bacterial energy metabolism and virulence:

  • Mitochondrial Manipulation: L. pneumophila effectors like Ceg3 (Lpg0080) ADP-ribosylate host ADP/ATP translocases (ANTs), disrupting mitochondrial ATP/ADP exchange to favor bacterial replication .

  • Host Cell Survival: The bacterium reverses mitochondrial FOF1-ATPase activity to ATP hydrolase mode, preserving host membrane potential (Δψm) and delaying apoptosis .

Enzymatic and Pathogenic Insights:

  • ADP-Ribosylation: Ceg3 modifies ANTs at a conserved arginine residue (within the -RRRMMM- motif), inhibiting mitochondrial ADP/ATP transport . This modification peaks 6–10 hours post-infection, correlating with maximal bacterial replication .

  • ATPase Activity: The DotB protein, a homolog of PilT ATPase, is essential for L. pneumophila’s type IV secretion system (T4SS). DotB hydrolyzes ATP (6.4 nmol/min/mg) to energize effector translocation .

Host Interactions:

  • V-ATPase Inhibition: Effector SidK targets host V-ATPase subunit VatA, neutralizing phagosome acidification to facilitate intracellular survival .

  • Transcriptional Regulation: The rsmYZ ncRNAs modulate CsrA activity, indirectly influencing atpB expression and bacterial virulence .

Applications in Research

Recombinant atpB is utilized in:

  • Vaccine Development: As an antigen for antibody production (e.g., Creative Biolabs’ VAng-Lsx04273) .

  • ELISA and Binding Assays: Commercial kits (e.g., Anagnostics’ CSB-CF722933LAAB) detect atpB in pathogenicity studies .

Key Research Challenges

  • Temporal Regulation: ADP-ribosylation of ANTs by Ceg3 is transient, suggesting dynamic effector interplay during infection .

  • Structural Dynamics: The noncanonical macrodomain of ARH Lpg0081 enables ADPr removal from ANTs, highlighting evolutionary adaptation .

Future Directions

  • Therapeutic Targeting: Inhibiting atpB or its modifying enzymes (e.g., Ceg3) could disrupt L. pneumophila’s energy hijacking .

  • Structural Studies: Cryo-EM of recombinant atpB complexed with host ANTs may reveal precise interaction sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
atpB; lpg1051; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Target Names
atpB
Target Protein Sequence
MGEEGFLAHFAFSIGGLPITQSVLTTWFIMISLFIMAWSTTYKCSLLQPSTYQLIWEGVL STMYDAIKEVLPEHVELIFPFVATLWIFILVSNLIGVIPGFYSPTADLSVTASLAIMTFL SVHWFGIRAEGWREYLKHYIKPTPFLLPFHLISEISRTLALAVRLFGNIMSLQLTALIVL MIAGFLVPIPILILHIIEAIIQAYIFGMLALIYIAGGIQAHELKSQGESL
Uniprot No.
Q5ZWN4

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links

KEGG: lpn:lpg1051

STRING: 272624.lpg1051

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.