Recombinant Legionella pneumophila subsp. pneumophila Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mscL; lpg2540; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Target Names
mscL
Target Protein Sequence
MSLLKEFKEFAMRGNVMDLAVAVVMGVAFNKIVTALVDGIIMPCVGLLLGGINIAGLSFT VGDVQIKWGNFLQNVIDFIIVAFAIFVLIKLINLLQRKKANEPEPVTPEIQLLTEIRDLL ARNSSKI
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: lpn:lpg2540

STRING: 272624.lpg2540

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Legionella pneumophila mscL channel and what is its significance in bacterial physiology?

The mscL (large-conductance mechanosensitive channel) in Legionella pneumophila is a membrane protein that responds to membrane tension by forming a pore, allowing the passage of ions and small molecules. This channel plays a critical role in bacterial osmoregulation, protecting cells from lysis during rapid osmotic downshifts by releasing solutes.

In L. pneumophila, mechanosensitive channels are particularly significant as this pathogen must adapt to diverse environments, from natural water sources to human alveolar macrophages during infection. The mscL channel helps maintain membrane integrity during these transitions between different osmotic environments .

What expression systems are typically used for recombinant L. pneumophila mscL production?

Recombinant L. pneumophila mscL is commonly produced using several expression systems:

Expression SystemAdvantagesLimitations
E. coliHigh yield, simple culture conditions, well-established protocolsPotential issues with membrane protein folding
YeastBetter for eukaryotic-like post-translational modificationsLower yield than bacterial systems
BaculovirusGood for larger proteins, maintains protein foldingMore complex, time-consuming system
Mammalian cellsBest for maintaining complex folding and modificationsLowest yield, highest cost

Most recombinant mscL for research applications is expressed in E. coli systems with affinity tags (often His-tags) for purification. To maintain protein integrity, the recombinant protein is typically stored in buffer containing glycerol to prevent freeze-thaw damage .

What electrophysiological techniques are most effective for characterizing L. pneumophila mscL channel activity?

Patch-clamp electrophysiology is the gold standard for functional characterization of mechanosensitive channels including L. pneumophila mscL. Several configurations are applicable:

  • Inside-out patch configuration: Allows direct access to the cytoplasmic domains of the channel and precise control of membrane tension through negative pressure (suction) applied to patch pipettes.

  • Whole-cell configuration: Enables measurement of total cellular mechanosensitive currents but may dilute cytoplasmic factors important for channel regulation.

  • Giant spheroplast approach: When expressing recombinant mscL in E. coli MJF465 strain (which lacks endogenous mechanosensitive channels MscL, MscS, and MscK), this technique provides a clean background for channel characterization .

  • Liposome reconstitution: Purified mscL protein can be reconstituted into azolectin liposomes for controlled electrophysiological measurements in a defined lipid environment .

The most reliable results are typically obtained using pressure-clamp systems that allow precise control of membrane tension while recording channel currents at defined holding potentials .

How can one optimize the reconstitution of recombinant L. pneumophila mscL into liposomes for functional studies?

Successful reconstitution of mscL into liposomes requires careful attention to several parameters:

ParameterOptimization Approach
Lipid compositionTypically use azolectin (soybean lipid extract) or defined mixtures of phosphatidylcholine, phosphatidylethanolamine, and cholesterol at ratios mimicking bacterial membranes
Protein-to-lipid ratioStart with 1:1000 to 1:100 (w/w) ratios; adjust based on desired channel density
Reconstitution methodDetergent-mediated reconstitution using detergents like DDM, OG, or CHAPS with controlled removal via dialysis or Bio-Beads
Buffer conditionsMaintain physiological pH (7.2-7.4) and ionic strength; include osmolytes like sucrose for stability
Size controlExtrusion through polycarbonate filters (100-400 nm) to create uniform-sized vesicles

For patch-clamp analysis, larger unilamellar blister formation is critical, which can be achieved by dehydration/rehydration cycles. Including trace amounts of fluorescent lipids can help visualize liposomes during patch-clamp experiments .

When comparing mscL function across species or mutants, co-reconstitution with a reference channel (like E. coli MscL) provides an internal standard for quantifying relative pressure sensitivity .

What are the key considerations when designing site-directed mutagenesis experiments for L. pneumophila mscL?

When designing mutagenesis studies for L. pneumophila mscL, researchers should consider:

  • Transmembrane domain mutations: Focus on conserved hydrophobic residues that line the pore and affect gating tension thresholds.

  • Comparative approach: Target residues that differ between L. pneumophila mscL and other bacterial mscL channels with known properties (e.g., E. coli mscL).

  • Cytoplasmic domain modifications: Investigate the C-terminal domain's role in channel function by systematic truncations or charge alterations.

  • Expression verification: Include epitope tags or fluorescent protein fusions that minimally impact function but allow verification of expression and localization.

  • Functional testing pipeline: Establish a systematic approach combining expression verification, localization studies, and electrophysiological characterization to fully assess mutant effects.

Based on studies of other bacterial mechanosensitive channels, key regions to target include the transmembrane helices involved in pore formation and the hydrophobic constriction that forms the channel gate .

How does the electrophysiological profile of L. pneumophila mscL differ from related mechanosensitive channels, and what are the functional implications?

The electrophysiological properties of L. pneumophila mscL show several distinctive features compared to other bacterial mechanosensitive channels:

PropertyL. pneumophila mscLComparison to E. coli MscSFunctional Implication
ConductanceApproximately 1-3 nS in 200 mM KClDifferent from MscS (~1 nS)Affects ion flux rates during osmotic stress
Pressure sensitivityActivation at -100 to -130 mmHg in spheroplastsSimilar activation range as MscSDefines the physiological conditions triggering channel opening
Ion selectivityWeak preference for anionsSimilar to MscSInfluences which solutes are released during hypoosmotic shock
Rectification behaviorLarger conductance at positive pipette voltagesSimilar to MscSAffects direction of ion flow under membrane potential
Inactivation kineticsDifferent inactivation profile compared to MscSMscS exhibits more pronounced inactivationDetermines how long channels remain open during sustained stress

Based on evidence from other MscS-family channels, these properties likely evolved to match the specific osmotic challenges faced by L. pneumophila in its natural aquatic habitats and during host cell infection .

What is the relationship between L. pneumophila mscL function and the bacterium's ability to survive in different environmental conditions?

L. pneumophila experiences diverse environments during its lifecycle, from natural freshwater to intracellular compartments in protozoan hosts and human macrophages. The mscL channel likely plays crucial roles in these transitions:

  • Environmental persistence: L. pneumophila can be found in natural water bodies, soil samples (9.28% detection rate), and man-made water systems (22.43% detection rate) . MscL likely contributes to survival during rapid osmotic shifts in these environments.

  • Biofilm formation: In water distribution systems, L. pneumophila forms biofilms where cells experience microenvironmental osmotic variations. MscL function may be critical during biofilm formation and dispersal.

  • Intracellular survival: During infection of amoebae or human macrophages, L. pneumophila resides in a specialized vacuole (Legionella-containing vacuole, LCV) . MscL may sense and respond to membrane tension changes during vacuole formation.

  • Transmission cycle: When infected host cells lyse, bacteria are released into the environment, experiencing sudden osmotic downshifts where mscL activation could prevent cell lysis.

Studies using Galleria mellonella infection models have shown significant strain-specific differences in L. pneumophila virulence , which could potentially relate to variations in mechanosensitive channel function across strains, though this connection remains to be directly investigated.

How might the structure-function relationship of L. pneumophila mscL be leveraged for antimicrobial development?

The essential role of mechanosensitive channels in bacterial survival makes mscL a potential antimicrobial target with several possible approaches:

  • Gain-of-function targeting: Compounds that lower the activation threshold of mscL could cause inappropriate channel opening, solute loss, and bacterial death. This approach offers advantages as:

    • It targets a conserved bacterial survival mechanism

    • Resistance would be difficult to develop without compromising osmotic stress responses

    • It represents a novel mechanism distinct from existing antibiotics

  • Structure-based targeting opportunities: Based on mechanosensitive channel studies, several regions of mscL present targetable features:

    • The hydrophobic gate region that controls channel opening

    • The interfacial region that senses membrane tension

    • Cytoplasmic domains that influence channel kinetics

  • Combination therapy potential: MscL-targeting compounds could potentially sensitize L. pneumophila to osmotic stress during conventional antibiotic treatment, enhancing efficacy.

  • Delivery considerations: Engineered liposomes incorporating mscL channels could potentially be used to deliver antimicrobial compounds specifically to bacteria in infected tissues.

This approach is particularly relevant for L. pneumophila infections, as current treatment relies primarily on macrolides and fluoroquinolones , and there is growing concern about antibiotic resistance .

How can recombinant L. pneumophila mscL be utilized in vaccine development research?

Recombinant L. pneumophila mscL protein has potential applications in vaccine development through several approaches:

  • Subunit vaccine component: As a membrane protein expressed across L. pneumophila strains, mscL could serve as a conserved antigen. Research shows that membrane proteins of L. pneumophila can induce protective immunity .

  • Delivery system for immunogenic epitopes: Engineered mscL channels could potentially display epitopes from immunogenic L. pneumophila proteins such as peptidoglycan-associated lipoprotein (PAL) .

  • Mechanism for adjuvant delivery: Reconstituted liposomes containing functional mscL could release adjuvants in response to specific stimuli.

  • Cross-protection potential: Due to conservation across Legionella species, mscL-based vaccines might provide broader protection than serogroup-specific approaches.

Current research has identified specific epitopes like PAL 92-100 (EYLKTHPGA) that induce strong CTL responses and provide protection against lethal L. pneumophila challenge . Similar approaches could be explored with mscL-derived epitopes.

What are the current technical challenges in studying the structure and gating mechanism of L. pneumophila mscL?

Despite advances in membrane protein research, several technical challenges remain in studying L. pneumophila mscL:

  • Structural determination limitations:

    • Obtaining sufficient quantities of stable, properly folded protein

    • Crystallization challenges inherent to membrane proteins

    • Maintaining native-like lipid environments during structural studies

  • Gating mechanism investigation difficulties:

    • Capturing transitional states during channel opening

    • Correlating structural changes with electrophysiological measurements

    • Developing sensors to monitor real-time conformational changes

  • In vivo relevance assessment:

    • Creating genetic tools for L. pneumophila that allow channel modification without disrupting pathogenesis

    • Developing methods to measure channel activity during infection

    • Correlating in vitro mechanistic findings with in vivo function

Current approaches to address these challenges include:

  • Employing lipid nanodiscs for maintaining native-like environments

  • Using cryo-electron microscopy for structural determination

  • Developing FRET-based sensors to monitor conformational changes

  • Implementing optogenetic approaches to control channel function

How might genomic diversity in mscL across L. pneumophila strains correlate with their virulence and environmental adaptations?

The genomic diversity of L. pneumophila includes potential variations in mechanosensitive channel genes that may influence strain-specific behaviors:

  • Strain-specific virulence: Studies have identified significant differences in virulence between L. pneumophila strains using the Galleria mellonella infection model, with mortality rates varying from 40% to 100% . Whether these differences correlate with mscL sequence variations remains unexplored.

  • Environmental distribution patterns: L. pneumophila has been detected in various environmental sources including water (22.43%) and soil (9.28%) samples . Sequence typing has revealed diverse strains across these environments.

  • Host range adaptations: L. pneumophila can infect multiple hosts, including various protozoan species and human macrophages. Experimental evolution studies have shown that host restriction can rapidly modify L. pneumophila fitness and host range , which might involve adaptations in membrane proteins like mscL.

  • Selective pressure in built environments: In man-made water systems, environmental filtering and competition may select for more resilient strains . These selective pressures could affect mechanosensitive channel function.

Future research directions should explore:

  • Systematic comparison of mscL sequences across clinical, environmental, and laboratory-adapted strains

  • Correlation between mscL sequence variations and functional properties

  • Assessment of how mscL mutations affect fitness in different environmental conditions

  • Evaluation of mscL as a potential marker for strain typing or virulence prediction

What quality control measures are essential when working with recombinant L. pneumophila mscL protein?

Ensuring the quality and functionality of recombinant L. pneumophila mscL requires rigorous quality control:

Quality Control ParameterMethodAcceptance Criteria
PuritySDS-PAGE analysis>90% single band at expected molecular weight (~13 kDa)
IdentityWestern blot or mass spectrometryPositive reaction with anti-His antibody; MS confirmation of sequence
Secondary structureCircular dichroism spectroscopyAlpha-helical content consistent with transmembrane protein
Oligomeric stateSize exclusion chromatographyPentameric assembly (expected for functional mscL)
Functional activityLiposome swelling assay or patch-clampPressure-dependent channel opening
StabilityThermal shift assayMelting temperature consistent with stable protein
Endotoxin contentLAL assay<1 EU/mg protein for cell-based applications

For reconstitution experiments, additional controls should include:

  • Verification of successful incorporation into liposomes using density gradient centrifugation

  • Orientation analysis to confirm proper protein insertion

  • Control reconstitutions with well-characterized channels (e.g., E. coli MscL) as benchmarks

How can researchers effectively compare data between patch-clamp studies of L. pneumophila mscL and other bacterial mechanosensitive channels?

Standardization is crucial when comparing electrophysiological data across different mechanosensitive channels:

  • Experimental conditions standardization:

    • Maintain consistent lipid composition in reconstituted systems

    • Standardize buffer compositions (particularly ionic strength)

    • Control pipette geometries and sizes (bubble number 3.8-4.6)

    • Use consistent pressure application protocols

  • Internal reference system:

    • Co-reconstitute with a well-characterized reference channel (e.g., E. coli MscL)

    • Calculate and report pressure ratios rather than absolute pressure values

    • The MscL/MscSP pressure activation ratio (1.28 ± 0.08) provides a normalized measure of mechanosensitivity

  • Data analysis approaches:

    • Apply consistent leak subtraction methods (e.g., P/4 procedure)

    • Standardize the definition of channel activation thresholds

    • Report both single-channel conductance and open probability statistics

  • Reporting standards:

    • Clearly document pipette resistance (3.5-5.1 MΩ range is typical)

    • Specify seal resistance values

    • Report temperature, which affects channel kinetics

    • Include raw traces alongside processed data

By implementing these standardization practices, researchers can generate comparable datasets across different mechanosensitive channels and laboratory settings .

What are the optimal methods for studying the interaction between L. pneumophila mscL and the bacterial membrane during host cell infection?

Investigating mscL-membrane interactions during infection requires specialized approaches:

  • Real-time imaging techniques:

    • Fluorescent protein fusions to mscL (minimally disruptive, e.g., at C-terminus)

    • Fluorescent lipid probes to visualize membrane domains

    • Super-resolution microscopy (STORM/PALM) to localize channels within bacterial membranes

    • FRET-based sensors to detect conformational changes during infection

  • Infectivity model systems:

    • Macrophage infection models (primary or cell lines like THP-1)

    • Amoebae models (Acanthamoeba castellanii)

    • Galleria mellonella (wax moth) larval model, which correlates well with mammalian infection patterns

    • Murine models for in vivo relevance

  • Membrane tension measurement approaches:

    • Fluorescent membrane tension sensors incorporated into bacterial membranes

    • Micropipette aspiration of infected host cells

    • Atomic force microscopy of bacteria during different infection stages

  • Genetic manipulation strategies:

    • Inducible expression systems to control mscL levels during infection

    • Point mutations affecting mechanical sensitivity without eliminating function

    • Domain swapping between mscL channels from different bacterial species

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.