Recombinant Legionella pneumophila subsp. pneumophila Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Molecular Function and Biological Significance

MsbA is an ATP-binding cassette (ABC) transporter responsible for flipping Lipid A—the hydrophobic anchor of LPS—from the inner to the outer leaflet of the bacterial inner membrane. This process is essential for LPS maturation and outer membrane integrity . In L. pneumophila, MsbA’s role extends to virulence, as LPS contributes to immune evasion and host cell invasion .

Key Functional Domains:

  • ATP-binding domain: Drives energy-dependent lipid translocation .

  • Permease domain: Facilitates Lipid A movement across the membrane .

  • Transmembrane helices: Anchors the protein within the lipid bilayer .

Recombinant Protein Production

Recombinant MsbA is synthesized in E. coli expression systems with a hexahistidine (His) tag for purification. Commercial variants include full-length (1–588 amino acids) and partial constructs .

Table 1: Recombinant MsbA Variants

SupplierUniProt IDProtein LengthTagPurityExpression HostSource Organism
MyBioSource Q5ZUH9PartialHis>85%Mammalian cellsL. pneumophila subsp. pneumophila
Creative BioMart Q5ZUH9Full (1–588 aa)His>90%E. coliL. pneumophila subsp. pneumophila
Creative BioMart Q5X498Full (1–588 aa)His>90%E. coliL. pneumophila

Research Applications

  1. Lipid Transport Studies: Used to dissect the structural mechanics of ABC transporters in Gram-negative bacteria .

  2. Antibiotic Development: Explored as a target for inhibitors disrupting LPS biosynthesis, a strategy to combat antibiotic-resistant strains .

  3. Pathogenesis Research: Investigated for its role in L. pneumophila virulence, particularly in evading host immune responses .

Challenges and Future Directions

While recombinant MsbA enables in vitro studies, its membrane-associated nature complicates crystallization for structural analysis. Current efforts focus on:

  • Engineering detergent-stable variants for cryo-EM .

  • High-throughput screening of MsbA inhibitors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you require a specific tag, please inform us and we will prioritize its development.
Synonyms
msbA; lpg1819; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Target Names
msbA
Target Protein Sequence
MKNNLPIKSRLLYKRLLSYVKPFWPVLLLGVLANILYSGIDAGFTYMTKLFLDKSFITID LNFVKQIPLIVLIGITLRGLVSSLGSYCMTWVARSVVKVLRQTVFSHIIHLPADYYDEAT SGQLLSKILYDVEQVAQVSADALTDFIQNICLVIGLLTVMMVICWQLSLMFLLTIPFVGI IVNYTNKRVRRISHKVQKTMGEVTEIASEAIEGYRVVRIFGGERYEITKFNKATEYSRKN DMKVAISKAINVSGVQLVIAIGIATIIMAAIHLSTVITISAGSFLAIIAAMLQLIKPMKT LTTLNATIQRGLAGAESVFNLLDLPLERNNGLILKEKIRGEIEFKHVYHAYRQGQNILHD VNFVIEAGTSVALVGHSGSGKTTIASLLPRFYELSQGMITLDGMPIQQLSLESLRKQMSL VSQNVTLFNDTLANNIAYGRFDASREQIITAAKLAYADEFIKQLPDGYDTRVGENGVLLS GGQRQRIAIARAILKDAPILILDEATSALDSESEHYIQAALEQVMKGRTTLIIAHRLSTI KHAHKIIVLQHGRIVEQGSHQELLDMDGHYAQLYKVQQFGRINEEVVA
Uniprot No.

Target Background

Function
MsbA, the Lipid A export ATP-binding/permease protein, is involved in the biosynthesis of lipopolysaccharide (LPS). It functions by translocating lipid A-core from the inner leaflet to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore in the inner membrane, while the ATP-binding domain (NBD) is responsible for generating energy required for this process.
Database Links

KEGG: lpn:lpg1819

STRING: 272624.lpg1819

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MsbA in Legionella pneumophila?

MsbA in Legionella pneumophila, similar to its homologs in other gram-negative bacteria, functions as an essential ABC transporter involved in lipopolysaccharide (LPS) trafficking. The primary role of MsbA is to flip newly synthesized core-lipid A from the cytoplasmic surface to the outer surface of the inner membrane . This translocation is a critical step in the biogenesis of the outer membrane, as it allows for the subsequent attachment of O-antigen polymers. In Legionella, this process is particularly important given the role of LPS in bacterial survival and virulence within host cells.

What experimental systems are available for studying recombinant Legionella pneumophila MsbA?

Multiple experimental systems can be employed to study recombinant Legionella pneumophila MsbA:

  • Heterologous Expression Systems:

    • E. coli-based expression using vectors optimized for membrane proteins

    • Yeast expression systems for eukaryotic post-translational modifications

    • Cell-free protein synthesis for rapid production

  • Purification Approaches:

    • Detergent-based extraction (DDM, LMNG)

    • Nanodisc reconstitution for maintaining native-like lipid environment

    • Lipid cubic phase crystallization for structural studies

  • Functional Assays:

    • ATPase activity measurements

    • Fluorescence-based lipid flipping assays

    • Complementation studies in temperature-sensitive mutants

When expressing recombinant Legionella MsbA, researchers should consider codon optimization for the expression host and include purification tags that minimally affect protein function. Temperature modulation during expression (typically 16-20°C) often enhances proper folding of membrane proteins.

What are the optimal conditions for expressing and purifying recombinant Legionella pneumophila MsbA?

The optimal expression and purification of recombinant Legionella pneumophila MsbA requires careful consideration of several factors:

Expression System Selection:

  • E. coli C41(DE3) or C43(DE3) strains are recommended for membrane protein expression

  • Expression vectors containing tightly regulated promoters (T7lac or araBAD) allow controlled induction

  • Fusion tags: N-terminal His10 with a TEV cleavage site minimizes interference with transport function

Expression Conditions:

ParameterRecommended ValueNotes
Temperature18°C post-inductionReduces inclusion body formation
Induction0.1-0.5 mM IPTGLower concentration for longer expression
MediaTerrific Broth + 1% glycerolEnhances membrane protein yields
Duration16-20 hoursExtended period for proper folding

Purification Protocol:

  • Membrane isolation via differential centrifugation (40,000 × g)

  • Solubilization in 1% n-dodecyl-β-D-maltoside (DDM) with 0.1% cholesteryl hemisuccinate

  • Immobilized metal affinity chromatography using nickel or cobalt resins

  • Size exclusion chromatography for obtaining monodisperse protein

The addition of 1-2 mM ATP and 5 mM MgCl₂ during purification helps stabilize the protein in its native conformation. For functional studies, reconstitution into proteoliposomes using E. coli polar lipid extracts supplemented with 10% phosphatidylglycerol provides a suitable membrane environment.

How can complementation studies be designed to assess Legionella pneumophila MsbA function?

Complementation studies represent a powerful approach to assess the functionality of recombinant Legionella pneumophila MsbA. These experiments can be designed using the following methodology:

  • Selection of Host Strain:

    • Temperature-sensitive E. coli MsbA mutants like WD2 (containing the A270T substitution) provide an ideal background

    • N. meningitidis msbA deletion strains offer an alternative system where MsbA is non-essential

  • Vector Construction:

    • Clone the Legionella pneumophila msbA gene into low or medium-copy number plasmids

    • Use inducible promoters to control expression levels

    • Include epitope tags for monitoring expression levels

  • Complementation Assay Design:

    Experimental ConditionControlTest
    Growth temperature30°C (permissive)44°C (non-permissive)
    MediaStandard LBLB with varying Mg²⁺ concentrations
    Inducer concentration0-100 μM range0-100 μM range
    Growth measurementOD600 readingsColony formation units
  • Functional Assessment:

    • Measure growth rates at non-permissive temperature

    • Analyze lipid A transport using radiolabeled precursors

    • Examine membrane integrity via fluorescent dye penetration assays

    • Isolate and characterize lipid A modifications by mass spectrometry

It's important to note that partial complementation may occur, as observed with N. meningitidis MsbA in E. coli WD2 . This suggests potential species-specific adaptations in substrate recognition or transport mechanism that should be considered when interpreting results.

What strategies can be employed to study the substrate specificity of Legionella pneumophila MsbA?

Understanding the substrate specificity of Legionella pneumophila MsbA requires multi-faceted experimental approaches:

  • In vitro Transport Assays:

    • Reconstitute purified MsbA into proteoliposomes with fluorescently labeled lipid A derivatives

    • Monitor ATP-dependent translocation using fluorescence quenching techniques

    • Compare transport rates of various lipid substrates including:

      • Native Legionella lipid A

      • Modified lipid A structures (varying acylation patterns)

      • Phospholipids to assess broader substrate recognition

  • Site-Directed Mutagenesis:

    • Target residues in the predicted substrate-binding pocket

    • Create chimeric proteins between Legionella MsbA and homologs with known specificity

    • Develop a library of point mutations in the transmembrane domains

  • Computational Approaches:

    • Molecular docking of lipid A variants to homology models

    • Molecular dynamics simulations to identify key interaction residues

    • Analysis of substrate access pathways through the transmembrane region

  • Crosslinking Studies:

    • Use photoactivatable lipid A analogs to identify binding sites

    • Employ mass spectrometry to map crosslinked residues

    • Validate findings through mutagenesis of identified interaction sites

Unlike E. coli MsbA, which transports both LPS and phospholipids, other bacterial species show different substrate profiles. For instance, in N. meningitidis, MsbA appears selective for LPS but not phospholipids . Determining whether Legionella pneumophila MsbA more closely resembles the E. coli or N. meningitidis pattern would provide valuable insights into its evolutionary adaptation and functional specialization.

How does Legionella pneumophila MsbA contribute to bacterial survival within host cells?

Legionella pneumophila is an intracellular pathogen that replicates within host cells, particularly in macrophages and amoebae. The contribution of MsbA to this lifestyle involves several interconnected mechanisms:

  • LPS Modification and Immune Evasion:
    MsbA-mediated transport of modified lipid A structures likely plays a crucial role in immune evasion. In Legionella, lipid A modifications can occur after MsbA-mediated flipping to the periplasmic face of the inner membrane . These modifications may alter recognition by host pattern recognition receptors, particularly Toll-like receptor 4 (TLR4), reducing inflammatory responses. Studies with temperature-sensitive MsbA mutants have shown that lipid A modifications occurring on the outer surface of the inner membrane are inhibited at non-permissive temperatures , highlighting MsbA's role in this process.

  • Membrane Integrity During Intracellular Replication:
    Proper outer membrane assembly, dependent on MsbA function, is essential for maintaining bacterial envelope integrity within the harsh phagosomal environment. Legionella must resist antimicrobial peptides and oxidative stress encountered within host cells. The effective transport of lipid A by MsbA ensures the maintenance of the asymmetric outer membrane that provides this protective barrier.

  • Type IV Secretion System Functionality:
    Legionella virulence depends heavily on the Dot/Icm Type IV secretion system (T4SS) to deliver effector proteins into host cells. The search results indicate that T4SS is highly conserved across Legionella species . Proper membrane assembly, facilitated by MsbA, may be crucial for the correct insertion and function of this secretion machinery in the bacterial envelope.

A significant research challenge remains in distinguishing the direct contributions of MsbA from the broader effects of disrupted LPS transport. Conditional mutants or chemical inhibitors that allow temporal control of MsbA function would enable more precise determination of its role during different stages of the intracellular lifecycle.

What are the implications of MsbA structure-function relationships for developing targeted antimicrobial strategies?

The essential nature of MsbA in many gram-negative bacteria makes it an attractive target for novel antimicrobial development. Understanding the structure-function relationships of Legionella pneumophila MsbA provides several avenues for targeted therapeutic approaches:

  • Exploiting Structural Features for Inhibitor Design:
    Recent structural studies of MsbA from various organisms have revealed multiple conformational states during the transport cycle . While high-resolution structures of Legionella MsbA are not yet available, homology modeling based on related structures can guide the design of inhibitors that:

    • Lock the transporter in specific conformations

    • Interfere with ATP binding or hydrolysis

    • Block the substrate-binding pocket

    • Disrupt the dimer interface critical for function

  • Targeting Species-Specific Features:
    Comparative analysis of MsbA across bacterial species reveals important differences:

    SpeciesEssential?Phospholipid TransportNotable Features
    E. coliYesYesTransports both LPS and phospholipids
    N. meningitidisNoNoSelective for LPS; not required for phospholipid export
    Legionella pneumophilaUnknownUnknownMay possess unique adaptations for intracellular survival

    These differences suggest that inhibitors could potentially be designed to target specific bacterial species while minimizing effects on others, reducing selection pressure for resistance development.

  • Combination Therapies:
    Inhibiting MsbA function could potentially sensitize Legionella to other antimicrobials that normally cannot penetrate the gram-negative outer membrane. For instance, MsbA inhibition might be combined with:

    • Macrolide antibiotics currently used for Legionella treatment

    • Antimicrobial peptides that target inner membrane integrity

    • Inhibitors of the LpxC enzyme in the lipid A biosynthetic pathway

  • Challenges in Development:
    Several obstacles remain in developing MsbA inhibitors:

    • Potential toxicity due to structural similarities with human ABC transporters

    • Complex membrane environment complicating drug delivery

    • Requirement for penetration of multiple bacterial membranes

    • Potential for rapid resistance development

An improved high-resolution structure of Legionella pneumophila MsbA, preferably with a well-defined ligand such as Kdo2-lipid A, would greatly facilitate the development of species-specific inhibitors .

How do environmental conditions influence MsbA expression and function in Legionella pneumophila?

Legionella pneumophila transitions between environmental reservoirs and host cells, encountering dramatically different conditions that likely influence MsbA expression and function:

  • Temperature-Dependent Regulation:
    Temperature shifts between environmental water sources (~25°C) and mammalian hosts (37°C) trigger extensive transcriptional reprogramming in Legionella. While specific data for Legionella MsbA is limited, studies with E. coli have demonstrated temperature-sensitivity of MsbA mutants . At elevated temperatures (42°C), lpxL mutants exhibit growth inhibition that can be rescued by MsbA overexpression . This suggests that temperature-responsive regulation of MsbA may be important during host infection.

  • Divalent Cation Sensing:
    The search results indicate that when grown with high concentrations of divalent cations, both E. coli and Salmonella produce lipid A species with altered phosphorylation patterns . In Legionella, sensing of environmental calcium and magnesium likely influences lipid A modification systems, which in turn affects the substrate profile that MsbA must transport. Research methodologies to investigate this include:

    • Culturing Legionella under varying cation concentrations

    • Analyzing transcriptional responses via RNA-seq

    • Characterizing lipid A structures by mass spectrometry

    • Measuring MsbA transport kinetics under different ionic conditions

  • Stress Response Integration:
    Within host cells, Legionella encounters various stresses including nutrient limitation, antimicrobial peptides, and oxidative damage. The bacterial envelope is a primary sensor of these stresses, suggesting MsbA function may be integrated with stress response pathways:

    Stress ConditionPotential Effect on MsbAExperimental Approach
    Nutrient starvationAltered expression levelsQuantitative proteomics
    Antimicrobial peptidesModified substrate specificityLipidomic analysis
    Oxidative stressPost-translational modificationsRedox proteomics
    pH shiftsConformational changesHydrogen-deuterium exchange MS
  • Biofilm Formation:
    Legionella forms biofilms in water systems, which serve as environmental reservoirs. The transition between planktonic and biofilm growth involves extensive envelope remodeling, potentially requiring altered MsbA activity. Research questions include:

    • Is MsbA expression different in biofilm versus planktonic cells?

    • Does lipid A structure change during biofilm formation?

    • Could MsbA inhibition prevent biofilm establishment?

These environmental adaptations highlight the need for experimental systems that can accurately replicate the conditions Legionella encounters throughout its lifecycle. Microfluidic devices that allow precise control of temperature, nutrient availability, and surface attachment would be particularly valuable for studying MsbA regulation in response to changing environments.

What are the major technical challenges in working with recombinant membrane proteins like Legionella pneumophila MsbA?

Working with recombinant Legionella pneumophila MsbA presents several significant technical challenges that researchers must overcome:

  • Expression and Solubilization Issues:
    Membrane proteins like MsbA often express poorly and can aggregate or misfold when overexpressed. Effective strategies include:

    • Using specialized E. coli strains (C41/C43, Lemo21) designed for membrane protein expression

    • Employing fusion partners (MBP, SUMO) to enhance solubility

    • Testing multiple detergents for optimal solubilization (DDM, LMNG, GDN)

    • Implementing directed evolution approaches to identify more stable variants

  • Maintaining Native Conformation:
    Preserving the native structure of MsbA outside its membrane environment is challenging. Solutions include:

    • Reconstitution into nanodiscs or amphipols to provide a membrane-like environment

    • Addition of specific lipids during purification that stabilize the protein

    • Using styrene-maleic acid copolymer lipid particles (SMALPs) to extract MsbA with its native lipid environment

  • Functional Assay Development:
    Assessing the transport activity of MsbA requires sophisticated assays that can monitor lipid flipping across membranes:

    Assay TypePrincipleAdvantagesLimitations
    ATPase activityMeasures ATP hydrolysisSimple, high-throughputIndirect measure of transport
    Fluorescent lipid analogsMonitors movement of labeled lipidsReal-time measurementsMay not accurately mimic natural substrates
    Radio-labeled substratesTracks movement of native substratesHigh specificityRequires radioactive materials handling
    Mass spectrometryDirectly measures transported lipidsComprehensive analysisLow throughput, complex sample preparation
  • Structural Analysis Complications:
    Obtaining high-resolution structural information about Legionella MsbA is complicated by:

    • Conformational heterogeneity during the transport cycle

    • Large size of the protein-detergent complex

    • Challenges in growing well-diffracting crystals

    Recent advances in cryo-electron microscopy have somewhat alleviated these issues, but sample preparation and image processing remain challenging.

Addressing these technical hurdles requires an integrated approach combining molecular biology, biochemistry, and biophysical techniques. Collaborative efforts between laboratories with complementary expertise can significantly accelerate progress in this challenging research area.

How can advanced imaging techniques be applied to study MsbA localization and dynamics in Legionella pneumophila?

Advanced imaging techniques offer powerful approaches to investigate MsbA localization, dynamics, and function in Legionella pneumophila:

  • Super-Resolution Microscopy Approaches:

    Techniques such as PALM, STORM, and STED microscopy enable visualization of MsbA distribution at nanometer resolution, overcoming the diffraction limit of conventional microscopy:

    • Methodology: Generate fluorescent protein fusions of MsbA that maintain functionality (verified through complementation studies)

    • Applications: Map MsbA distribution relative to other envelope components and secretion systems

    • Key Insights: Determine whether MsbA forms specialized membrane domains or associates with specific protein complexes

    Implementation requires careful controls to ensure that fluorescent tags do not disrupt protein localization or function. C-terminal tagging is often preferred for ABC transporters to minimize interference with transmembrane domains.

  • Single-Molecule Tracking:

    Monitoring individual MsbA molecules in living bacteria provides insights into its dynamic behavior:

    • Methodology: Use photoactivatable fluorescent proteins or quantum dots coupled to antibody fragments

    • Applications: Measure diffusion coefficients, identify confined movement, and detect potential oligomerization events

    • Analysis Approaches: Mean square displacement analysis, hidden Markov modeling, and Bayesian inference methods

    This approach can reveal whether MsbA mobility changes during different growth phases or infection stages, potentially indicating functional regulation.

  • Fluorescence Resonance Energy Transfer (FRET):

    FRET enables the study of protein-protein interactions and conformational changes:

    FRET ApplicationExperimental DesignExpected Outcome
    Conformational dynamicsDual-labeled MsbA (donor/acceptor)Measure nucleotide-dependent conformational changes
    Protein interactionsMsbA-LPS synthesis enzymes labeled pairsIdentify potential multiprotein complexes
    Substrate bindingLabeled MsbA and fluorescent lipid ADetermine binding kinetics in living cells
  • Correlative Light and Electron Microscopy (CLEM):

    CLEM combines the molecular specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy:

    • Methodology: Locate MsbA using fluorescence, then examine the same region by electron microscopy

    • Applications: Visualize MsbA in relation to membrane architecture and intracellular organelles

    • Specialized Approaches: Cryo-CLEM to visualize proteins in their native state without fixation artifacts

    This technique is particularly valuable for studying Legionella within host cells, allowing visualization of MsbA in relation to the Legionella-containing vacuole membrane.

  • Expansion Microscopy:

    Physical expansion of specimens coupled with standard confocal microscopy offers an accessible super-resolution approach:

    • Methodology: Embed fixed bacteria in a swellable polymer, then expand uniformly

    • Advantages: Uses standard microscopes, compatible with many fluorophores

    • Applications: Mapping spatial relationships between MsbA and other bacterial components

These advanced imaging approaches are most powerful when combined with genetic and biochemical methods. For example, imaging can be performed in strains with altered lipid A structures or under conditions that modify MsbA expression to correlate localization patterns with functional states.

What genomic and evolutionary insights might be gained from comparative analysis of MsbA across Legionella species?

Comparative genomic analysis of MsbA across Legionella species offers valuable insights into evolutionary adaptation and functional specialization:

  • Phylogenetic Analysis of MsbA Homologs:
    The search results indicate that whole-genome sequencing of diverse Legionella isolates has revealed significant genetic diversity . A dedicated analysis of MsbA homologs could:

    • Establish evolutionary relationships between MsbA variants

    • Identify selective pressure signatures in different ecological niches

    • Correlate MsbA sequence variations with pathogenic potential

    Particularly interesting would be comparison between L. pneumophila and non-pneumophila species, as the search results indicate that L. pneumophila is the most common and severe pathogen in the genus .

  • Structural Domain Conservation:

    DomainExpected ConservationFunctional Significance
    Nucleotide binding domainsHighEssential for ATP hydrolysis
    Transmembrane domainsModerateSpecies-specific substrate recognition
    Substrate binding pocketVariableAdaptation to lipid A structural variations
    Dimer interfaceHighCritical for transport mechanism

    Mapping the conservation patterns onto structural models would highlight regions potentially involved in species-specific functions.

  • Horizontal Gene Transfer Assessment:
    The search results mention that horizontal gene transfer (HGT) from other bacterial species is recognized as a source of diversity in the Legionella genus . Analysis of MsbA sequences could reveal:

    • Evidence of recombination events

    • Potential acquisition of domains from other bacterial transporters

    • Mosaic structures indicating evolutionary innovation

  • Correlation with Lipid A Structural Diversity:
    Different Legionella species likely produce structurally distinct lipid A molecules. Comparing MsbA sequences with lipid A structures could:

    • Identify co-evolution patterns between transporter and substrate

    • Reveal adaptations for specific lipid A modifications

    • Provide insights into substrate recognition mechanisms

  • Methodological Approaches:

    • Whole-genome sequencing of environmental and clinical Legionella isolates

    • Targeted amplification and sequencing of msbA genes from diverse samples

    • Biochemical characterization of lipid A structures from corresponding species

    • Heterologous expression studies to assess functional differences between homologs

The findings from such comparative genomic analyses could guide the design of species-specific inhibitors and provide insights into how Legionella has adapted to diverse environmental conditions and host ranges. This research direction would particularly benefit from integrating genomic data with functional characterization of the corresponding MsbA proteins.

How might systems biology approaches advance our understanding of MsbA's role in Legionella pneumophila pathogenesis?

Systems biology approaches offer powerful frameworks for understanding MsbA within the broader context of Legionella pneumophila pathogenesis:

  • Integrative Multi-omics Analysis:
    Combining multiple data types can reveal connections between MsbA function and global cellular processes:

    • Transcriptomics: Identify genes co-regulated with msbA during infection cycles

    • Proteomics: Map protein-protein interaction networks involving MsbA

    • Lipidomics: Characterize lipid A and phospholipid compositions under various conditions

    • Metabolomics: Assess energetic requirements and metabolic shifts associated with MsbA activity

    Integration of these datasets can reveal regulatory networks and functional relationships not apparent from any single approach.

  • Network Analysis and Modeling:
    Mathematical modeling of LPS transport and outer membrane biogenesis can:

    • Predict rate-limiting steps in membrane assembly

    • Simulate the effects of MsbA inhibition on membrane integrity

    • Identify potential compensatory mechanisms when MsbA function is compromised

    • Model the effects of environmental conditions on lipid transport dynamics

  • Genome-Scale Interaction Screening:

    ApproachMethodologyExpected Insights
    Synthetic genetic arrayCombine msbA mutations with genome-wide knockoutsIdentify genetic interactions and compensatory pathways
    Chemical-genetic profilingScreen for compounds that specifically affect msbA mutantsDiscover synergistic drug targets
    Suppressor mutation analysisIdentify mutations that restore viability to compromised MsbAReveal functional relationships and alternative transport mechanisms
  • Host-Pathogen Interface Analysis:
    Systems-level characterization of host responses to Legionella with altered MsbA function:

    • Transcriptional profiling of infected host cells

    • Phosphoproteomic analysis of signaling pathway activation

    • Imaging-based phenotypic profiling of host-pathogen interactions

    These approaches can reveal how MsbA-dependent LPS modifications influence host recognition and immune responses.

  • Computational Prediction of Critical Nodes:
    Network analysis algorithms can identify:

    • Hub proteins that interact with multiple pathways

    • Bottleneck proteins that serve as critical connections between processes

    • Evolutionarily conserved modules that may represent fundamental systems

    If MsbA emerges as a critical node in these networks, it would further validate its potential as a therapeutic target.

The implementation of these systems biology approaches requires collaborative efforts between microbiologists, structural biologists, computational scientists, and immunologists. The resulting integrated view of MsbA function would provide a foundation for rational design of intervention strategies targeting Legionella pneumophila infections.

What are the most promising research opportunities for understanding and targeting Legionella pneumophila MsbA?

Based on current knowledge and technological capabilities, several research directions offer particularly promising opportunities for advancing our understanding of Legionella pneumophila MsbA:

  • Structural Biology Breakthroughs:
    Recent advances in cryo-electron microscopy have revolutionized membrane protein structural biology. Obtaining high-resolution structures of Legionella pneumophila MsbA in multiple conformational states would:

    • Reveal species-specific adaptations in substrate binding pockets

    • Identify conformational changes during the transport cycle

    • Provide templates for structure-based inhibitor design

    • Clarify the molecular basis for lipid selectivity

    As noted in the literature, an improved high-resolution structure of MsbA, preferably with a well-defined ligand such as Kdo2-lipid A, would greatly facilitate mechanistic studies .

  • Infection Model Systems:
    Developing more sophisticated infection models to study MsbA function during the Legionella intracellular lifecycle:

    • Genetically tractable amoeba hosts to study environmental persistence

    • Human lung-on-chip models that recapitulate respiratory epithelium

    • Conditional MsbA expression systems for temporal control during infection

    • In vivo imaging of MsbA localization during different infection stages

  • Therapeutic Development Pathways:

    ApproachKey AdvantagesTechnical Challenges
    Small molecule inhibitorsTraditional drug development pathwaySelectivity over human ABC transporters
    Peptide-based inhibitorsPotential for higher specificityDelivery across bacterial membranes
    RNA-targeting approachesHighly specific gene silencingNucleic acid delivery challenges
    Combination therapiesLower resistance developmentComplex drug interaction profiles
  • Environmental Monitoring Applications:
    The search results describe environmental surveillance for Legionella species , which could be enhanced through MsbA-focused approaches:

    • Development of molecular probes for species identification based on msbA sequences

    • Correlation of MsbA variants with environmental persistence and virulence

    • Assessment of MsbA as a biomarker for treatment efficacy in water systems

  • Fundamental Transport Mechanisms:
    Resolving longstanding questions about lipid flipping mechanisms:

    • Does MsbA function as a "credit card swipe" model or through other mechanisms?

    • How is substrate specificity determined between LPS and phospholipids?

    • What is the energetic coupling between ATP hydrolysis and lipid movement?

    • Do accessory proteins modulate MsbA function in Legionella?

These research opportunities are most powerful when pursued in an integrated fashion, with findings from fundamental studies informing applied approaches and vice versa. Collaborative research networks that bring together expertise in structural biology, microbiology, infection biology, and drug discovery offer the most promising path toward comprehensive understanding and effective targeting of Legionella pneumophila MsbA.

How might research on Legionella pneumophila MsbA contribute to broader understanding of bacterial membrane biogenesis?

Research on Legionella pneumophila MsbA has the potential to advance our fundamental understanding of bacterial membrane biogenesis beyond the specific pathogen context:

  • Evolutionary Diversity in LPS Transport Systems:
    Comparative analysis between Legionella MsbA and homologs from other bacterial species can illuminate evolutionary solutions to the lipid transport challenge. The search results highlight interesting differences between organisms:

    • In E. coli, MsbA is essential and transports both LPS and phospholipids

    • In N. meningitidis, MsbA is non-essential, and phospholipid export occurs independently

    • In Legionella, the specific properties remain to be fully characterized

    These differences suggest multiple evolutionary pathways for solving the fundamental problem of asymmetric bilayer assembly, with implications for understanding membrane biogenesis across bacterial diversity.

  • Integration of Lipid Transport with Broader Cellular Processes:

    Legionella's complex lifecycle provides an excellent model to study how membrane biogenesis is coordinated with:

    • Stress responses during environmental transitions

    • Virulence factor expression and secretion

    • Metabolic adaptation to different growth environments

    • Cell envelope remodeling during different growth phases

  • Fundamental Biophysics of Lipid Transport:

    Research QuestionSignificanceExperimental Approaches
    Energy coupling mechanismsHow ATP hydrolysis drives lipid movementSite-directed mutagenesis, biophysical measurements
    Substrate recognition principlesMolecular basis for lipid selectivityStructural studies, in vitro transport assays
    Membrane perturbation during transportHow large amphipathic molecules cross the bilayerMolecular dynamics simulations, fluorescence spectroscopy
    Transport stoichiometryNumber of ATP molecules per lipid translocatedQuantitative transport assays
  • Alternative Lipid Transport Pathways:

    The viability of N. meningitidis msbA deletion mutants raises fundamental questions about alternative lipid transport mechanisms that may exist in other bacteria, including Legionella:

    • Do redundant transporters exist for certain lipid classes?

    • Can other ABC transporters compensate for MsbA loss?

    • Do non-ABC transport systems contribute to membrane assembly?

    Investigating these questions in Legionella could reveal novel principles of membrane biogenesis.

  • Methodological Advances:

    Technical innovations developed for studying Legionella MsbA may have broad applications:

    • New assays for measuring lipid flipping across membranes

    • Improved approaches for membrane protein expression and purification

    • Advanced imaging techniques for visualizing membrane assembly in living cells

    • Computational methods for predicting lipid-protein interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.