Recombinant Legionella pneumophila subsp. pneumophila Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Legionella pneumophila subsp. pneumophila Membrane Protein Insertase YidC (yidC) is a bacterial enzyme critical for the insertion and folding of membrane proteins. This 556-amino-acid protein (UniProt ID: Q5ZR81) is produced recombinantly in Escherichia coli systems for research and biotechnological applications . YidC belongs to the conserved Oxa1/YidC/Alb3 family, which facilitates Sec-independent membrane protein integration and plays roles in bacterial virulence .

Protein Architecture

  • Domains: YidC features six transmembrane helices, with a large periplasmic domain between helices 1 and 2 .

  • Active Site: A hydrophobic slide formed by transmembrane helices TM3 and TM5 mediates substrate recognition and insertion .

PropertySpecification
SpeciesLegionella pneumophila subsp. pneumophila (strain Paris)
SourceRecombinant expression in E. coli
TagN-terminal His-tag
Protein LengthFull-length (1-556 amino acids)
Molecular Weight~60 kDa (predicted)
Purity>90% (SDS-PAGE verified)

Mechanism of Action

YidC operates via two pathways:

  1. Sec-YidC Synergy: Collaborates with the Sec translocon for polytopic membrane proteins .

  2. Sec-Independent Insertion: Directly integrates single-spanning proteins (e.g., Pf3 coat) into lipid bilayers .

    • Key residues (e.g., YidC-5S mutant) impair interaction with SecYEG but retain activity for Sec-independent substrates .

Production Workflow

  • Cloning: Full-length yidC gene (lpg3002) cloned into E. coli expression vectors .

  • Expression: Induced under optimized conditions (e.g., IPTG induction).

  • Purification: Affinity chromatography via His-tag, followed by lyophilization in Tris/PBS buffer with 6% trehalose .

Quality Control

  • Purity: Validated by SDS-PAGE (>90%) .

  • Activity: Functional assays using proteoliposomes confirm membrane insertion capability .

Vaccine Development

  • Used as an antigen in Legionella vaccine studies due to its surface exposure and role in pathogenesis .

Membrane Protein Biogenesis Studies

  • Model system for investigating Sec-independent insertion mechanisms .

  • Critical for studying bacterial virulence factors, including Dot/Icm effectors .

Pathogenesis Insights

  • YidC homologs in Legionella contribute to mitochondrial ATP transport manipulation via effectors like LncP .

  • Genomic recombination hotspots involving yidC enhance bacterial adaptation and virulence .

Insertase Activity

StudyKey ResultCitation
Pf3 coat insertionYidC proteoliposomes insert 150 Pf3 molecules per YidC molecule enzymatically
SecYEG interactionYidC-5S mutant disrupts SecY binding but retains substrate specificity
Mitochondrial targetingLegionella effector LncP hijacks host mitochondria via YidC-like mechanisms

Genetic and Evolutionary Significance

  • yidC resides in genomic recombination hotspots, driving L. pneumophila adaptation .

  • Homologous recombination barriers exist between L. pneumophila subspecies, preserving YidC functionality .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
yidC; lpg3002; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-556
Protein Length
full length protein
Species
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Target Names
yidC
Target Protein Sequence
MDIRRIVLYMALALIGLSLWNAWQIDYPAKQPVEEKTASQLTSDGHLLPQIIPSNAEQPV TLKAEEKASSGKQLIQVKTDVLDVDIDLKNGDIVKGLLLDYPLSVEDKNKPFPLLQNQAS QRYVANSSLFVLDGQTPQSLDFDFTSEKEYYELKPDQNQLIVTLNGKSEDGLDVKKEFVF TKGSYLIEVNYKIANTGNSLWKGYFNTQLLRSSPKEDKSSIFHIGSYTGASFSNPGKNRY QKVSFSDMSKSNLDVDAKGGWIAMQQHYFLSAWVPNADSENKFYTLATDKDYTIGAVSQP ITVKPKEDKIVGSKLYIGPEITSVLKGISPSLDLTVDYGILWFLSSLLFSLMKAIYTVVG NWGWSIVLVTVLIKLAFYRLSATSYKSMASMRKLQPKLQALRERYGDDKAKISQATMELY KQEKVNPLGGCLPILIQIPVFIALYWVLLESVELRQAPFIFWINDLASADPYHVLPLIMG ATMLIQQKLNPAPADPMQAKVMMFLPILFTGLFWNFPSGLVLYWIVNNTLSILQQWYITR KYSDEKPAKKVVATAK
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also aids in the folding of multispanning membrane proteins.
Database Links

KEGG: lpn:lpg3002

STRING: 272624.lpg3002

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Legionella pneumophila YidC and what is its primary function in bacterial physiology?

YidC is a critical membrane protein insertase belonging to the Oxa1 superfamily that plays an essential role in the biogenesis of the bacterial inner membrane in Legionella pneumophila. It significantly influences membrane protein composition and lipid organization . YidC functions through two primary mechanisms:

  • As a co-insertase with the Sec translocon: YidC aids in the proper folding of multi-pass membrane proteins during their integration into the lipid bilayer

  • As an independent insertase: YidC facilitates the insertion of smaller membrane proteins without requiring the Sec machinery

YidC also possesses lipid scramblase activity, contributing to the organization of the phospholipid bilayer . This dual functionality highlights YidC's importance in maintaining membrane integrity while assisting in the proper insertion and arrangement of other membrane proteins.

What experimental systems are used to study YidC function in Legionella pneumophila?

Several complementary experimental approaches have been established to investigate YidC function:

  • In vitro translation/insertion assays: This method uses inverted membrane vesicles (INVs) to assess protein insertion efficiency. Research has shown that INVs enriched with YidC interactor proteins like YibN can stimulate insertion of substrates such as Pf3 coat protein, M13 procoat H5, and ATP synthase subunit F0c by approximately 1.5-1.8 fold compared to control vesicles .

  • Co-expression studies: These involve expressing YidC substrates alongside potential interactor proteins (like YibN) in bacterial systems. Samples are collected at regular intervals and analyzed by SDS-PAGE and Western blot to monitor synthesis rates .

  • Proximity-dependent biotin labeling (BioID): This technique identifies proteins that exist in close proximity to YidC in its native environment, leading to discoveries such as YibN as a crucial component within the YidC protein environment .

  • Affinity purification-mass spectrometry (AP-MS): SILAC-AP/MS experiments have confirmed that YidC and interactor proteins like YibN can reciprocally capture each other, demonstrating stable interaction .

  • Translocation assays: For studying Legionella secretion systems, calmodulin-dependent adenylate cyclase from Bordetella pertussis (CyaA) can be fused to proteins of interest, and translocation is detected by measuring cyclic AMP production .

What are the known substrates of Legionella pneumophila YidC?

YidC facilitates the insertion of several membrane proteins in Legionella pneumophila:

SubstrateProtein TypeYidC DependenceEffect of YibN Co-expression
M13 procoat (PC)Phage coat proteinHighSignificantly increased synthesis
Pf3 coat proteinPhage coat proteinHighSignificantly increased synthesis
ATP synthase subunit F0cMulti-pass membrane proteinHighSignificantly increased synthesis
SecGTwo transmembrane segmentsDemonstratedSignificantly increased biogenesis
YajCSingle-pass membrane proteinNot affected by YidC depletionNot affected by YibN
YhcBSingle-pass membrane proteinNot affected by YidC depletionNot affected by YibN

Research indicates that the hydrophobicity of transmembrane segments influences YidC dependence. For example, the SecG I20E mutation in the first transmembrane segment reduces the effect of YibN on SecG biogenesis, suggesting that hydrophobicity is an important factor in YidC-mediated insertion .

How does the newly identified YidC-YibN interaction affect membrane protein insertion mechanisms?

The discovery of YibN as a bona fide interactor of YidC represents a significant advancement in understanding membrane protein insertion mechanisms. Previously, YidC was thought to operate independently, but recent proximity-dependent biotin labeling (BioID) studies have revealed YibN as a critical component within the YidC protein environment .

The functional significance of this interaction is multi-faceted:

  • Enhancement of substrate insertion: In vitro translation/insertion assays using inverted membrane vesicles (INVs) have demonstrated that YibN-enriched membranes support a 1.5-1.8-fold stimulation of insertion for various YidC substrates including Pf3 coat protein, M13 procoat H5, and ATP synthase subunit F0c .

  • Substrate-specific effects: YibN significantly increases the biogenesis of proteins with multiple transmembrane segments like SecG, but has little effect on single-pass membrane proteins like YajC and YhcB. This suggests a substrate-specific mechanism .

  • Transmembrane segment requirement: Deletion of YibN's unique transmembrane segment abolishes its association with YidC, indicating that their interaction likely occurs within the hydrophobic interior of the lipid bilayer .

  • Influence on lipid organization: YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC's lipid scramblase activity .

This interaction challenges the conventional view that YidC functions alone and suggests a more complex interplay of factors influencing membrane protein biogenesis.

What methodological approaches are most effective for studying YidC's dual role as an insertase and lipid scramblase?

Investigating YidC's dual functionality requires a combination of specialized techniques:

  • For insertase activity assessment:

    • In vitro translation/insertion assays: Using purified components and radiolabeled substrates with proteinase K digestion to identify membrane-protected fragments . This approach allows quantification of insertion efficiency and can detect different topological forms (as seen with SecG, which produces multiple membrane-protected fragments) .

    • Co-expression time-course experiments: Monitoring substrate synthesis rates in the presence or absence of YidC or its interactors through regular sampling and Western blot analysis .

  • For lipid scramblase activity:

    • Membrane proliferation assays: Overexpression of YidC interactors like YibN followed by electron microscopy can reveal changes in membrane proliferation that may result from altered scramblase activity .

    • Fluorescent lipid analog translocation assays: Although not explicitly mentioned in the search results, this would be a standard approach to directly measure scramblase activity.

  • For structural studies informing both functions:

    • Cryo-electron microscopy: This has been used to determine the structure of YidC-ribosome complexes, revealing how YidC interacts with the ribosome at the tunnel exit and identifying sites for membrane protein insertion at the YidC protein-lipid interface .

    • Evolutionary co-variation analysis: Combined with lipid-versus-protein-exposure data and molecular dynamics simulations, this approach has yielded structural models of YidC showing its distinctive arrangement of five transmembrane domains and a helical hairpin between TM2 and TM3 .

The most effective research strategy integrates these approaches to correlate structural features with both insertase and scramblase activities.

How does YidC's function in Legionella pneumophila compare to its role in other bacterial pathogens?

YidC is a universally conserved protein across bacteria, but its specific functions and interactions in Legionella pneumophila show some notable differences compared to other bacterial species:

  • Interaction with pathogenesis machinery:

    • In Legionella pneumophila, YidC likely plays a role in the biogenesis of components necessary for the Dot/Icm type IV secretion system, which is critical for virulence and located at the bacterial poles . This polar localization of secretion machinery is crucial for Legionella's virulence, as nonpolar export of Dot/Icm effectors has been shown to be ineffectual .

    • In contrast, YidC in E. coli has been extensively studied for its role in the insertion of lactose permease (LacY) and subunit II of cytochrome o oxidase .

  • Interactor proteins:

    • In Legionella pneumophila, YibN has been identified as a specific interactor that enhances YidC's insertase function .

    • The closest related protein in the Oxa1 superfamily, Oxa1L, interacts with TMEM126A in other systems , suggesting that interactor proteins may be specific to different bacterial species.

  • Substrate specificity:

    • In Legionella, YidC appears to be involved in the insertion of proteins that may contribute to the unique two-step secretion pathway for transmembrane effectors .

    • In E. coli, YidC is known to facilitate the insertion of small phage coat proteins like Pf3 and M13 in a Sec-independent pathway .

  • Structural adaptation:

    • The YidC structural groove is linked to a membrane bilayer thinning mechanism that reduces energy expenditure for translocation . This feature may be particularly important in the context of Legionella's intracellular lifestyle within both protozoan hosts and human macrophages .

Understanding these comparative differences is crucial for developing targeted antimicrobial strategies that might disrupt YidC function specifically in Legionella pneumophila without affecting commensal bacteria.

What role might YidC play in the biogenesis of Legionella pneumophila's secretion systems?

Legionella pneumophila utilizes several specialized secretion systems to establish infection, particularly the Dot/Icm type IV secretion system (T4SS). Evidence suggests YidC likely plays a critical role in the biogenesis of these systems:

  • Membrane component insertion: The Dot/Icm system contains multiple membrane-embedded components that require proper insertion into the bacterial inner membrane. YidC, as a membrane insertase, would be expected to facilitate the integration of these components .

  • Polar localization requirements: Research has demonstrated that the Dot/Icm secretion system is restricted to both poles of the Legionella bacterium, and this polarized localization is critical for virulence . YidC might contribute to this polar targeting through its role in membrane protein organization.

  • Two-step secretion pathway support: Legionella features a two-step secretion pathway with an inner membrane intermediate for the secretion of transmembrane effectors . YidC could be involved in establishing this inner membrane intermediate stage by facilitating the initial insertion of these effectors.

  • Coordination with other secretion machinery: In addition to the T4SS, Legionella possesses other secretion systems including Type I (Lss), Type II (Lsp), and additional Type IV systems (Lvh) . YidC may play differential roles in the assembly of these varied secretion machineries.

The functional relationship between YidC and these secretion systems represents an important area for future research, as it could reveal potential targets for therapeutic intervention in Legionella infections.

What experimental approaches can detect the in vivo dynamics of YidC-mediated membrane protein insertion during Legionella infection?

Studying the real-time dynamics of YidC function during active Legionella infection presents unique challenges that require specialized techniques:

  • Infection model fluorescence microscopy:

    • Researchers have successfully employed GFP-tagged domains of secreted effectors in transiently transfected cells challenged with Legionella to visualize protein localization during infection .

    • A similar approach could be adapted for YidC substrates, potentially using split-GFP systems where one fragment is fused to YidC and another to the substrate.

  • Time-course proteomics during infection:

    • Sequential sampling of infected cells followed by membrane fractionation and quantitative proteomics can reveal the changing membrane proteome composition in a YidC-dependent manner.

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) approaches have been used successfully to study YidC interactions and could be adapted to infection models.

  • Translocation assays with YidC dependency:

    • The calmodulin-dependent adenylate cyclase (CyaA) fusion system has been used to monitor the translocation of Legionella effectors . This system could be modified to assess how YidC depletion affects the translocation of membrane-associated effectors.

  • Selective membrane permeabilization:

    • Techniques involving selective permeabilization of infected macrophages (using PLP fixation solution containing 0.1% methanol) can help distinguish between proteins in different compartments during infection .

    • This approach could help track YidC-dependent protein localization during the infection process.

  • Live-cell imaging with super-resolution microscopy:

    • Although not explicitly mentioned in the search results, technologies such as PALM or STORM microscopy would enable visualization of YidC-substrate interactions at nanoscale resolution during infection.

These methodologies, particularly when used in combination, can provide valuable insights into the dynamic role of YidC during Legionella pathogenesis.

How can researchers effectively engineer recombinant YidC proteins to study structure-function relationships?

Engineering recombinant YidC variants requires careful consideration of structure-function relationships. Based on available research, the following methodological approaches are recommended:

  • Expression system selection:

    • Recombinant Legionella pneumophila YidC has been successfully expressed in E. coli, yeast, baculovirus, and mammalian cell systems . Each system offers advantages:

      • E. coli: High yield but may lack proper post-translational modifications

      • Yeast: Better for eukaryotic-like modifications

      • Baculovirus/Mammalian: Most suitable for complex functional studies

  • Domain-specific modifications:

    • YidC contains five conserved transmembrane domains with a distinctive arrangement . Structure-function studies should target:

      • The helical hairpin between TM2 and TM3 on the cytoplasmic membrane surface

      • The hydrophilic groove that facilitates translocation

      • Regions involved in bilayer thinning

  • Fusion strategies:

    • Creating functional fusion proteins:

      • N-terminal tags are preferable since the C-terminus may be involved in ribosome binding

      • FLAG-tag or His-tag constructs facilitate purification without significantly affecting function

      • Fluorescent protein fusions should be connected via flexible linkers to minimize structural disruption

  • Mutational analysis targets:

    • Key residues for investigation:

      • Hydrophobic amino acids in the transmembrane regions that interact with substrate proteins

      • Residues in the hydrophilic groove that contribute to insertase activity

      • Amino acids involved in YibN interaction, which has been shown to enhance YidC function

  • Functional validation assays:

    • Insert-loss-of-function mutations can be complemented with recombinant constructs and tested for:

      • In vitro translation/insertion using inverted membrane vesicles (INVs)

      • Substrate protection from proteinase K digestion

      • Membrane-protected fragment (MPF) analysis

When designing experiments, researchers should consider that deletion of YibN's unique transmembrane segment abolishes its association with YidC , suggesting that transmembrane interactions are critical for complex formation and function.

What is the relationship between YidC function and Legionella pneumophila virulence?

The relationship between YidC and Legionella virulence is multifaceted and likely involves several interconnected mechanisms:

  • Support for secretion system biogenesis: Legionella pneumophila's virulence depends heavily on its Dot/Icm type IV secretion system, which translocates approximately 300 effector proteins into host cells . As a membrane insertase, YidC likely facilitates the proper assembly of components of this secretion machinery.

  • Contribution to membrane organization: The Dot/Icm secretion system is specifically localized to the bacterial poles, and this polar localization is critical for Legionella's virulence . Research has demonstrated that when this polar organization is disrupted (e.g., through treatment with the MreB inhibitor A22), bacteria become significantly less able to avoid the host endocytic pathway . YidC's role in membrane protein organization may contribute to maintaining this critical polar localization.

  • Effector protein biogenesis: Many Legionella effector proteins are membrane-associated, including those with transmembrane domains. For instance, Legionella employs a two-step secretion pathway with an inner membrane intermediate for secreting transmembrane effectors . YidC could be involved in the proper folding and membrane integration of these effectors before their secretion.

  • Adaptation to host environments: Legionella must adapt to diverse intracellular environments, from amoebae to human macrophages . YidC's function in membrane protein insertion may be particularly important during these host transitions, enabling appropriate membrane remodeling.

This relationship between YidC and virulence suggests that targeting YidC or its interactions could represent a novel approach to attenuating Legionella virulence.

How does YidC contribute to Legionella pneumophila's adaptation to different host environments?

Legionella pneumophila is unique in its ability to infect both environmental protozoa and human macrophages . YidC likely plays a crucial role in facilitating this remarkable host adaptability:

  • Membrane composition adjustment:

    • Different host environments present varying membrane stress conditions. YidC's dual function as an insertase and lipid scramblase would enable Legionella to rapidly adjust its membrane composition in response to these changing conditions.

    • The lipid scramblase activity may be particularly important during host transitions, helping to maintain membrane symmetry and fluidity under different environmental stresses.

  • Stress response protein insertion:

    • YidC facilitates the insertion of proteins required for stress responses. During the transition between hosts or within the harsh phagolysosomal environment, rapid insertion of stress response proteins would be crucial for bacterial survival.

    • The interaction between YidC and YibN enhances the insertion of certain membrane proteins , potentially providing an additional regulatory mechanism during host adaptation.

  • Secretion system modulation:

    • The Legionella-containing vacuole (LCV) undergoes substantial remodeling during infection, recruiting various host organelles including endoplasmic reticulum vesicles, ribosomes, and mitochondria .

    • YidC-mediated insertion of bacterial factors into the LCV membrane could facilitate these interactions with host organelles, creating an optimal replicative niche in different host cell types.

  • Evasion of host defense mechanisms:

    • In both amoebae and macrophages, Legionella must avoid fusion with lysosomes . This requires specific membrane proteins to be properly inserted and functional.

    • YidC likely ensures the correct integration of factors that prevent phagosome-lysosome fusion, a process that is mechanistically conserved between protozoan and mammalian hosts .

These adaptive functions underscore YidC's importance beyond basic membrane protein insertion, highlighting its role as a key contributor to Legionella's environmental versatility and pathogenic potential.

What are the promising methodological approaches for targeting YidC function in potential therapeutic strategies?

Targeting YidC function represents a novel approach for developing antimicrobial strategies against Legionella pneumophila. Several methodological approaches show promise:

  • High-throughput screening for small molecule inhibitors:

    • Utilizing in vitro translation/insertion assays with YidC-enriched inverted membrane vesicles (INVs) to screen compound libraries for molecules that specifically inhibit YidC insertase activity .

    • Assay readout could measure insertion efficiency of model substrates like SecG or M13 procoat protein using proteinase K protection assays.

  • Peptide inhibitors targeting YidC-YibN interaction:

    • The discovery that YidC interacts with YibN through transmembrane domains suggests that peptide mimics of these interaction interfaces could disrupt the functional complex.

    • Synthetic peptides corresponding to the transmembrane segment of YibN could potentially compete with native YibN and reduce YidC function enhancement.

  • CRISPR interference (CRISPRi) for conditional knockdown:

    • Since YidC is likely essential, complete knockout may not be viable. CRISPRi allows for titratable repression of gene expression during specific stages of infection.

    • This approach could help identify temporal windows when YidC function is most critical for pathogenesis.

  • Structure-based drug design:

    • Utilizing structural models of YidC based on evolutionary co-variation analysis, lipid-versus-protein-exposure data, and molecular dynamics simulations to design compounds that specifically bind to and inhibit the hydrophilic groove involved in protein translocation.

  • Anti-virulence approach through secretion system disruption:

    • Rather than directly targeting YidC, compounds could be designed to interfere with the polar localization of the Dot/Icm secretion system , potentially by affecting YidC-dependent membrane organization.

    • The fact that A22 treatment (which affects bacterial cell morphology) significantly reduced Legionella's ability to avoid the host endocytic pathway provides proof-of-concept for this approach.

The effectiveness of these strategies would need to be evaluated not only for their antimicrobial efficacy but also for their specificity to Legionella YidC over homologs in beneficial bacteria and human cells.

What are the optimal conditions for expressing and purifying recombinant Legionella pneumophila YidC?

Successful expression and purification of recombinant Legionella pneumophila YidC requires careful optimization of several parameters:

  • Expression system selection:

    • Multiple systems have been used for recombinant YidC expression, including E. coli, yeast, baculovirus, and mammalian cells .

    • E. coli is often preferred for high-yield membrane protein expression, though careful strain selection is critical. C41(DE3) or C43(DE3) strains, derived from BL21(DE3), are engineered specifically for membrane protein expression and can reduce toxicity issues.

  • Expression construct design:

    • Affinity tags: N-terminal His6 or His10 tags facilitate purification while minimizing interference with function

    • Fusion partners: MBP (maltose-binding protein) can enhance solubility

    • Protease cleavage sites: TEV protease recognition sequences allow for tag removal under mild conditions

  • Cultivation parameters:

    • Temperature: Lower temperatures (16-20°C) after induction typically improve proper folding of membrane proteins

    • Induction: Gentle induction with low IPTG concentrations (0.1-0.5 mM) or auto-induction media

    • Media supplements: Addition of 1% glucose can help reduce basal expression

  • Membrane extraction and solubilization:

    • Detergent selection is critical: n-Dodecyl β-D-maltoside (DDM) at 1-2% is commonly used for initial solubilization

    • For structural studies or functional assays, milder detergents like n-Decyl-β-D-Maltopyranoside (DM) may be preferable

    • Solubilization should be performed with gentle agitation at 4°C for 1-2 hours

  • Purification strategy:

    • Two-step purification protocols are recommended:

      • Initial IMAC (immobilized metal affinity chromatography) using Ni-NTA resin

      • Secondary purification via size exclusion chromatography

    • Buffer optimization: Including glycerol (10%) and reducing agents can enhance stability

  • Quality assessment:

    • Functional validation using in vitro translation/insertion assays with inverted membrane vesicles

    • Structural integrity assessment via circular dichroism or thermal shift assays

For subsequent functional studies, reconstitution into proteoliposomes using E. coli polar lipid extracts can provide a native-like membrane environment for assessing YidC activity.

What are the key experimental controls needed when studying YidC-substrate interactions?

Robust experimental design for studying YidC-substrate interactions requires several critical controls:

  • For in vitro translation/insertion assays:

    • Positive controls:

      • Include well-established YidC substrates like Pf3 coat protein or M13 procoat

      • Use membrane vesicles enriched with known levels of YidC

    • Negative controls:

      • YidC-depleted membrane vesicles

      • Non-YidC dependent membrane proteins (e.g., YajC or YhcB have been shown not to be affected by YidC depletion or YibN expression)

    • Specificity controls:

      • Mutated substrate variants with altered hydrophobicity (e.g., SecG I20E) to verify substrate specificity

      • Proteinase K treatment without membrane permeabilization to confirm proper membrane insertion

  • For co-expression studies:

    • Expression monitoring:

      • Regular sampling to create a time-course profile (e.g., every 15 minutes)

      • Total protein content measurement to ensure comparable expression conditions

    • Growth controls:

      • Monitor bacterial growth rate to ensure comparable cell densities

      • Use empty vector controls instead of simply uninduced conditions

  • For protein-protein interaction studies:

    • Reciprocal co-immunoprecipitation:

      • Pull down with antibodies against both YidC and the substrate of interest

    • Competition controls:

      • Include excess untagged protein to demonstrate binding specificity

    • Domain deletion variants:

      • Test interaction with truncated proteins to identify binding domains

      • The deletion of YibN's unique transmembrane segment abolished its association with YidC, demonstrating its importance

  • For in vivo localization studies:

    • Bacterial strain controls:

      • Use both virulent and avirulent strains (e.g., L. pneumophila ΔdotA strain and wild-type)

    • Fixation controls:

      • Selective permeabilization to distinguish between proteins in different compartments

      • Different fixation methods to ensure observed localization is not a fixation artifact

  • For functional validation:

    • Complementation tests:

      • YidC depletion followed by complementation with recombinant variants

    • Substrate specificity verification:

      • Test multiple substrates to distinguish general effects from substrate-specific phenomena

The integration of these controls ensures that observed effects can be specifically attributed to YidC-substrate interactions rather than experimental artifacts or indirect effects.

How can researchers effectively compare YidC function across different bacterial species in standardized assays?

Conducting standardized comparative analyses of YidC function across bacterial species requires careful methodological consideration:

  • Heterologous expression system standardization:

    • Express YidC homologs from different species in a common host (typically E. coli) using identical promoters, ribosome binding sites, and expression conditions

    • Normalize expression levels through quantitative Western blotting or fluorescent tagging

    • Use inducible promoters (like PBAD or Ptet) that allow fine-tuning of expression across different constructs

  • Substrate panel selection:

    • Create a standardized panel of known YidC substrates from different species:

      • Conserved substrates (ATP synthase subunit c, SecG)

      • Species-specific substrates

      • Model substrates (M13 procoat, Pf3 coat protein)

    • Include substrates with modified hydrophobicity profiles (e.g., SecG I20E) to test substrate specificity across species

  • In vitro translation/insertion assay optimization:

    • Prepare inverted membrane vesicles (INVs) using identical protocols across species

    • Develop a standardized quantification method for membrane-protected fragments following proteinase K digestion

    • Control for membrane protein:lipid ratios across different preparations

  • Complementation testing:

    • Establish a YidC depletion system in E. coli

    • Test complementation with heterologous YidC proteins from different species

    • Measure growth curves, substrate insertion efficiency, and membrane integrity

  • Interaction partner analysis:

    • Compare interactomes using standardized BioID or AP-MS protocols

    • Test cross-species interactions (e.g., does Legionella YidC interact with E. coli YibN homologs?)

    • Quantify binding affinities using surface plasmon resonance or microscale thermophoresis

  • Structural constraint mapping:

    • Apply evolutionary co-variation analysis across species

    • Compare lipid-versus-protein-exposure patterns

    • Identify conserved versus species-specific structural elements

  • Lipid environment normalization:

    • Reconstitute YidC proteins in liposomes with defined lipid compositions

    • Test function in synthetic membranes that mimic different bacterial membrane compositions

    • Assess lipid scramblase activity across species

This standardized approach enables meaningful comparison of YidC functional differences between Legionella pneumophila and other bacterial species, potentially revealing species-specific adaptations that could be exploited for targeted antimicrobial development.

What emerging technologies are advancing our understanding of YidC structure and function?

Recent technological advances are transforming our ability to investigate YidC structure and function:

  • Cryo-electron microscopy (cryo-EM) innovations:

    • Advanced cryo-EM has enabled visualization of YidC-ribosome complexes, revealing how a single copy of YidC interacts with the ribosome at the tunnel exit

    • Time-resolved cryo-EM now allows for capturing different states of the insertion process

    • This approach identified a site for membrane protein insertion at the YidC protein-lipid interface

  • Integrative structural biology approaches:

    • Combining evolutionary co-variation analysis with lipid-versus-protein-exposure data and molecular dynamics simulations has yielded detailed structural models of YidC

    • These models reveal the distinctive arrangement of conserved transmembrane domains and the helical hairpin between TM2 and TM3 on the cytoplasmic membrane surface

  • Proximity-based protein interaction mapping:

    • BioID (proximity-dependent biotin labeling) has led to the identification of previously unknown YidC interactors, such as YibN

    • This technique is revealing a more complex protein network around YidC than previously recognized

  • Advanced proteomics methodologies:

    • SILAC-AP/MS (stable isotope labeling with amino acids in cell culture followed by affinity purification-mass spectrometry) has confirmed reciprocal capture of YidC and interactor proteins

    • Quantitative proteomics now enables precise measurement of changes in membrane proteome composition upon YidC depletion or mutation

  • Single-molecule techniques:

    • Single-molecule FRET (Förster resonance energy transfer) can now track conformational changes during the insertion process

    • Optical tweezers combined with fluorescence microscopy allow measurement of forces involved in membrane protein insertion

  • Membrane mimetic systems:

    • Nanodiscs and lipid cubic phase crystallization provide more native-like environments for structural studies

    • Microfluidic devices coupled with lipid bilayers enable real-time monitoring of insertion events

These technological advances are collectively driving a much deeper understanding of YidC's molecular mechanism, revealing it to be part of a dynamic network of interactions rather than functioning as an isolated insertase.

What are the unresolved questions regarding YidC function in Legionella pneumophila?

Despite significant progress in understanding YidC, several critical questions remain unanswered, particularly in the context of Legionella pneumophila:

  • Substrate recognition specificity:

    • What features determine whether a membrane protein requires YidC for insertion in Legionella?

    • How does the hydrophobicity threshold for YidC dependence (as observed with SecG I20E) vary across different substrates?

    • Are there Legionella-specific recognition motifs for YidC substrates?

  • Role in secretion system biogenesis:

    • To what extent does YidC contribute to the assembly of the Dot/Icm type IV secretion system?

    • Does YidC play a role in the two-step secretion pathway for transmembrane effectors described in Legionella ?

    • How does YidC contribute to the polar localization of secretion machinery, which is critical for Legionella virulence ?

  • Coordination with other insertion pathways:

    • How does YidC functionally interact with the Sec translocon in Legionella?

    • Are there Legionella-specific adaptations in the coordination between these pathways?

    • Do other insertases or chaperones complement YidC function in Legionella?

  • Regulation during infection:

    • How is YidC activity regulated during different stages of the Legionella infection cycle?

    • Does YidC function differently when Legionella infects protozoan hosts versus human macrophages?

    • Is YidC activity modulated in response to environmental stressors encountered during infection?

  • Interaction network complexity:

    • Beyond the recently identified YibN interaction , what other proteins interact with YidC in Legionella?

    • How does the YidC interactome change during different growth conditions or infection stages?

    • Are there host factors that interact with bacterial YidC during infection?

  • Therapeutic targeting potential:

    • Can YidC function be selectively inhibited in Legionella without affecting commensal bacteria?

    • Would targeting YidC-YibN interaction be an effective antimicrobial strategy?

    • How would resistance to YidC inhibitors develop, and what would be the fitness cost?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and infection models to fully understand the role of YidC in Legionella pneumophila pathogenesis.

How might research on YidC inform broader understanding of membrane protein biogenesis across bacterial species?

Research on Legionella pneumophila YidC offers valuable insights into fundamental principles of membrane protein biogenesis that extend beyond this specific pathogen:

  • Evolutionary conservation and adaptation:

    • YidC belongs to the evolutionarily conserved Oxa1 superfamily, which includes related proteins across bacteria, mitochondria, and chloroplasts

    • Comparing Legionella YidC with homologs from other species reveals both conserved mechanisms and species-specific adaptations

    • This evolutionary perspective helps identify core insertase functions versus specialized activities that emerged in different bacterial lineages

  • Interactor network complexity:

    • The discovery of YibN as a YidC interactor in Legionella challenges the previous view that bacterial YidC operates alone

    • This finding suggests that other bacterial species likely possess similar, yet-to-be-discovered interactor networks

    • Understanding how these networks vary across species may reveal how bacteria adapt their membrane protein biogenesis machinery to different ecological niches

  • Mechanistic insights into insertase function:

    • Studies on Legionella YidC contribute to our understanding of how membrane protein insertases generally function

    • The dual role as both an insertase and lipid scramblase suggests a more complex function than previously appreciated

    • The mechanism of substrate recognition, involving hydrophobicity thresholds as seen with SecG variants , may represent a universal principle

  • Coordination between insertion pathways:

    • Research on how Legionella YidC works with the Sec translocon illuminates principles of pathway coordination

    • This understanding helps explain how bacteria maintain proteostasis through coordinated action of multiple insertion systems

    • Insights from these studies may reveal shared regulatory mechanisms across diverse bacterial species

  • Structural principles of membrane protein integration:

    • The structural model of YidC based on evolutionary co-variation analysis reveals fundamental principles about how insertases interact with substrate proteins and the lipid bilayer

    • The identified membrane protein insertion site at the YidC protein-lipid interface likely represents a conserved feature across the insertase family

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.