Recombinant Legionella pneumophila subsp. pneumophila NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Legionella pneumophila?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the NADH dehydrogenase I complex in Legionella pneumophila. This protein, encoded by the gene nuoK (also known as lpg2779), functions within the respiratory chain of the bacterium. The full-length protein consists of 101 amino acids and has been successfully expressed recombinantly with an N-terminal His-tag in E. coli expression systems . The amino acid sequence of the full-length protein is: MIPVYDYLVLGVILFGLSLVGIMLNRKNIILLLVCVELMLLAVNTNFIAFSHYYNEVGGQVFVFFILTVAAAEAAIGLAIVMLLYRNRGNIDVDKMNHLKG . It serves as part of the NADH dehydrogenase complex that catalyzes electron transfer from NADH to quinones in the respiratory electron transport chain.

What are the optimal storage conditions for recombinant nuoK protein?

For optimal preservation of recombinant nuoK protein activity, the following storage protocol is recommended:

• Upon receipt, briefly centrifuge the vial to bring contents to the bottom

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (optimally 50%)

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• Store at -20°C or preferably -80°C for long-term storage

• For working stocks, aliquots can be maintained at 4°C for up to one week

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. The storage buffer typically consists of Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

How is nuoK protein related to Legionella pneumophila pathogenicity?

While the search results don't directly address the relationship between nuoK and L. pneumophila pathogenicity, we can infer important connections based on the available information. L. pneumophila is a facultative intracellular parasite and the causative agent of Legionnaires' disease . As a component of the respiratory chain, nuoK likely plays a critical role in energy metabolism during infection. The bacterium's ability to acquire nutrients and maintain energy production inside host cells is essential for its pathogenicity.

Research has shown that L. pneumophila can produce a nonclassical siderophore called legiobactin under iron-limited conditions, which is crucial for iron acquisition during infection . While nuoK is not directly involved in siderophore production, both systems (respiratory chain and iron acquisition) are essential for the pathogen's survival and virulence within host cells. The proper functioning of respiratory chain components like nuoK would be necessary for the bacterium to generate sufficient energy for growth and virulence factor expression.

What are the optimal expression and purification protocols for recombinant nuoK protein?

Based on the successful production of recombinant nuoK protein described in the search results, the following expression and purification methodology is recommended:

Expression System:

• Host: E. coli (specific strain optimization may be required)

• Vector: Expression vector containing N-terminal His-tag

• Target sequence: Full-length Legionella pneumophila nuoK (1-101 amino acids)

• Induction conditions: Optimize IPTG concentration, temperature, and duration for maximum yield

Purification Protocol:

• Cell lysis under native conditions using appropriate buffer systems

• Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

• Wash steps with increasing imidazole concentrations to remove non-specific binding

• Elution with high imidazole buffer

• Buffer exchange to remove imidazole

• Optional secondary purification step (size exclusion chromatography)

• Concentration determination using SDS-PAGE and protein assays

• Lyophilization in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

Quality control should confirm >90% purity as determined by SDS-PAGE analysis . For membrane proteins like nuoK, optimization of detergent conditions during extraction and purification is critical to maintain native conformation and function.

How can researchers effectively study electron transfer mechanisms in nuoK-containing complexes?

To study electron transfer mechanisms involving nuoK-containing complexes, researchers can adapt methodologies used for similar oxidoreductase systems, such as those described for NAD(P)H:quinone oxidoreductase and Na+-translocating NADH:quinone oxidoreductase:

Experimental Approaches:

• Heterodimer Expression Systems:

  • Design expression systems that produce wild-type/mutant heterodimers to study subunit cooperation

  • Tag one subunit (e.g., with polyhistidine) to enable selective purification

  • Analyze enzyme kinetics with different electron acceptors to determine subunit functional relationships

• Kinetic Analysis:

  • Measure enzyme activity using various electron acceptors (e.g., two-electron acceptors like 2,6-dichloroindophenol and menadione, or four-electron acceptors like methyl red)

  • Determine Km and kcat values to assess substrate affinity and catalytic efficiency

  • Compare wild-type, mutant, and heterodimer kinetics to identify functional differences

• Spectroscopic Techniques:

  • Electron paramagnetic resonance (EPR) spectroscopy to detect organic radicals formed during electron transfer

  • Monitor radical formation under varying conditions (e.g., different ion concentrations) to assess environmental effects on enzyme function

• Ligand Binding Studies:

  • Surface plasmon resonance to measure binding kinetics of quinones

  • Saturation transfer difference NMR to identify binding sites and dynamics

  • Photoactivatable quinone derivatives to identify functional sites

These methodologies can be adapted to specifically study nuoK's role in the NADH dehydrogenase complex of L. pneumophila.

What approaches can be used to investigate the structure-function relationship of nuoK in membrane environments?

Investigating structure-function relationships of membrane proteins like nuoK requires specialized techniques:

Structural Analysis:

• Membrane Protein Crystallization:

  • Detergent screening to identify optimal solubilization conditions

  • Lipidic cubic phase or bicelle crystallization methods

  • Optimization of crystallization parameters (pH, temperature, additives)

  • X-ray diffraction analysis to determine atomic structure

• Cryo-Electron Microscopy:

  • Sample preparation in nanodiscs or amphipols to maintain native-like environment

  • Single-particle analysis to determine structure at near-atomic resolution

  • Sub-classification to identify different conformational states

Functional Analysis:

• Site-Directed Mutagenesis:

  • Identification of conserved residues for targeted mutagenesis

  • Expression of mutant proteins and functional characterization

  • Correlation of structural elements with functional outcomes

• Reconstitution Studies:

  • Incorporation of purified nuoK into proteoliposomes

  • Measurement of electron transfer activities in the reconstituted system

  • Assessment of the effects of lipid composition on protein function

• Inhibitor Studies:

  • Use of specific inhibitors like DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) that have been shown to inhibit similar quinone oxidoreductases

  • Analysis of inhibition kinetics to identify binding sites and mechanisms

These approaches would provide valuable insights into how nuoK functions within the membrane environment and how its structure relates to its role in the respiratory chain.

How does nuoK from Legionella pneumophila compare with homologous proteins in other bacteria?

A comprehensive comparative analysis of nuoK from L. pneumophila with homologous proteins from other bacteria reveals important evolutionary and functional insights:

Structural Comparison:
While specific structural comparison data for L. pneumophila nuoK is limited in the search results, we can infer similarities and differences based on known characteristics of NADH:quinone oxidoreductases across bacterial species. Similar oxidoreductase complexes, such as the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) from Vibrio cholerae, have been extensively studied .

The key differences likely include:

• Ion specificity (H+ vs Na+ translocation)

• Subunit composition and arrangement

• Cofactor requirements and binding sites

• Regulatory mechanisms

Functional Comparison:
The NADH:quinone oxidoreductase complexes across different bacteria serve similar fundamental roles in respiratory electron transport chains but exhibit species-specific adaptations:

• Ion Translocation Specificity:

  • Some bacteria use H+-translocating complexes while others use Na+-translocating systems

  • The Na+-NQR from V. cholerae specifically translocates Na+ and Li+ ions but not K+ or Rb+

  • The ion specificity of L. pneumophila nuoK-containing complexes would be an important comparative feature

• Cofactor Utilization:

  • Different bacterial oxidoreductases utilize varying cofactor combinations

  • The Na+-NQR from V. cholerae contains a [2Fe-2S] cluster, FAD, riboflavin, FMNs, and potentially Q8

  • Comparative analysis of cofactor requirements would reveal evolutionary adaptations

What role does nuoK play in the adaptation of Legionella pneumophila to different host environments?

Legionella pneumophila is a remarkable pathogen that can replicate within various protozoan hosts in the environment and also infect human macrophages, causing Legionnaires' disease . The role of nuoK in this host adaptation process can be analyzed from several perspectives:

Metabolic Flexibility:
As a component of the respiratory chain, nuoK likely contributes to the metabolic flexibility required for adaptation to different intracellular environments. The bacterium must adjust its energy metabolism depending on the available nutrients within different host cells. The NADH:quinone oxidoreductase complex containing nuoK would be instrumental in maintaining energy production under varying conditions.

Experimental Evolution Studies:
Research on L. pneumophila's experimental evolution in mouse macrophages suggests that cycling through multiple protozoan hosts in the environment maintains the bacterium in a state of evolutionary stasis as a broad host-range pathogen . The restricted growth of L. pneumophila in a single host type leads to specific adaptations. The respiratory chain components, including nuoK, would likely undergo selective pressure during such host restriction experiments.

Host-Specific Adaptations:
The search results suggest that L. pneumophila can produce specific adaptations in response to environmental conditions, such as the production of the siderophore legiobactin under iron-limited conditions . Similarly, the regulation and function of respiratory chain components like nuoK might be modified in response to specific host environments.

How does nuoK interact with iron acquisition systems in Legionella pneumophila?

While direct interactions between nuoK and iron acquisition systems are not explicitly discussed in the search results, we can analyze potential functional relationships based on the available information:

Iron Requirement for Respiratory Chain Function:
The NADH:quinone oxidoreductase complex, of which nuoK is a part, contains iron-sulfur clusters as essential cofactors. Therefore, proper function of this respiratory complex depends on adequate iron availability within the bacterial cell.

Legiobactin Siderophore System:
L. pneumophila produces a nonproteinaceous, high-affinity iron chelator called legiobactin under iron-limited conditions . This siderophore system allows the bacterium to acquire iron from the environment.

Integration of Systems:

• Metabolic Coordination: The expression and activity of both systems (respiratory chain and iron acquisition) likely require coordinated regulation to ensure efficient energy production.

• Iron-Dependent Regulation: The search results indicate that the addition of 0.5 or 2.0 μM iron to cultures represses the expression of legiobactin . Similar iron-dependent regulation might affect the expression of respiratory chain components, including nuoK.

• Energy Requirement for Siderophore Production: The production and export of siderophores require energy, which is partly generated by the respiratory chain containing nuoK.

What methods can be used to study nuoK involvement in reactive oxygen species (ROS) generation?

Based on research with related bacterial oxidoreductases, nuoK may be involved in ROS generation during respiration. The following methods can be adapted from studies on Na+-NQR in Vibrio cholerae to investigate ROS production involving nuoK-containing complexes:

Experimental Approaches:

• Detection of Organic Radicals:

  • Electron paramagnetic resonance (EPR) spectroscopy to detect ubisemiquinone radicals generated during electron transfer

  • Analysis of radical formation under varying conditions (e.g., different ion concentrations)

• Measurement of Superoxide Production:

  • Cytochrome c reduction assay to quantify extracellular superoxide production

  • Comparison between wild-type and nuoK mutant or knockout strains

  • Analysis of the effect of environmental conditions (e.g., Na+ concentration) on superoxide formation

• Hydrogen Peroxide Quantification:

  • Amplex Red/horseradish peroxidase assay to measure H₂O₂ production

  • Comparative analysis between wild-type and nuoK-deficient strains

  • Correlation of H₂O₂ production with growth conditions and metabolic states

Experimental Data Table: Based on similar studies with Na+-NQR from V. cholerae, the following patterns might be expected:

This table is modeled after data observed for Na+-NQR in V. cholerae and represents the expected pattern for L. pneumophila if nuoK plays a similar role in ROS generation.

How can nuoK be utilized as a target for studying Legionella pneumophila infection models?

The nuoK protein can serve as a valuable target for investigating L. pneumophila pathogenesis through several research approaches:

Gene Knockout/Mutation Studies:

Host Cell Infection Models:

• Compare wild-type and nuoK-modified strains in macrophage and amoeba infection models

• Assess intracellular replication rates and bacterial survival

• Analyze differences in phagosome manipulation and intracellular trafficking

• Evaluate host cell responses, including inflammatory cytokine production

Experimental Evolution Approach:
Following the methodology described in search result , researchers could:

• Restrict L. pneumophila to growth within specific host cell types (e.g., mouse macrophages)

• Monitor genetic changes in nuoK and related genes over multiple passages

• Correlate genetic changes with functional adaptations in respiratory metabolism

• Identify host-specific selection pressures acting on respiratory chain components

What are the methodological considerations for investigating nuoK inhibitors as potential antimicrobial agents?

Research on inhibitors targeting nuoK or nuoK-containing complexes would involve several methodological considerations:

Inhibitor Screening Approaches:

• High-throughput screening:

  • Develop assays to measure NADH oxidation and quinone reduction activities

  • Screen chemical libraries for compounds that inhibit these activities

  • Evaluate specificity by comparing effects on bacterial vs. mammalian homologs

• Structure-based design:

  • Utilize structural information (if available) to design targeted inhibitors

  • Apply molecular docking and virtual screening approaches

  • Synthesize and test candidate compounds based on computational predictions

Inhibition Mechanism Studies:

• Kinetic analysis:

  • Determine inhibition modes (competitive, non-competitive, mixed)

  • Measure IC₅₀ and Ki values for promising compounds

  • Analyze effects on enzyme-substrate interactions

• Binding studies:

  • Apply techniques like surface plasmon resonance and saturation transfer difference NMR to study inhibitor binding

  • Identify binding sites through photoaffinity labeling or hydrogen-deuterium exchange

  • Evaluate binding stoichiometry and affinity constants

From studies on related systems, compounds like DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) have been shown to inhibit quinone reduction by Na+-NQR in a mixed inhibition mode . Similar approaches could be applied to identify and characterize inhibitors specific to nuoK-containing complexes in L. pneumophila.