Recombinant Legionella pneumophila subsp. pneumophila UPF0761 membrane protein lpg0643 (lpg0643)

Shipped with Ice Packs
In Stock

Description

Classification

  • KEGG Orthology: Classified under membrane proteins (K07058) .

  • Functional Annotation: UPF0761 family, with potential roles in membrane integrity, transport, or signaling .

Membrane Protein Functions

As an integral membrane protein, lpg0643 likely participates in:

  1. Transport: Facilitating ion or nutrient exchange across the membrane .

  2. Recognition: Acting as a receptor or adhesion molecule for host-cell interaction .

  3. Enzymatic Activity: Anchoring metabolic pathways to the membrane .

  4. Mechanosensing: Responding to mechanical stress within the lipid bilayer, as observed in other membrane proteins .

Expression and Purification

ParameterDetailSource
HostE. coli
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Research Tools

  • Antigenic Studies: The recombinant lpg0643 protein can serve as a target for antibody development or diagnostic assays.

  • Membrane Biology: Useful for studying protein-lipid interactions, particularly in pathogens with complex membrane structures.

Clinical Relevance

  • Pathogenicity: While lpg0643’s role in disease remains unclear, its presence in clinical isolates and recombination-prone regions suggests potential contributions to bacterial survival or immune evasion .

  • Target Validation: Further studies could explore lpg0643 as a therapeutic target for Legionnaires’ disease.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
lpg0643; UPF0761 membrane protein lpg0643
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-412
Protein Length
full length protein
Species
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Target Names
lpg0643
Target Protein Sequence
MNWKDKVKTTFYSCDRFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFP VFQGLAEPVQNFIFDNFVPATGKIVQSYLQQFTSQVSKLSIWGIVFLIFTALLVMFTIER AMNKIWRVSSSRHGVSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAPYTILHY SPFFLSLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYALLYG AFATVPIFFIWVYWVWIITLLGAEISYAFSVHHQRRGGKSLDGFSHALLWLHQLWLAQQH GKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADGHYMLSRDLSHVTLYDLTQLL PYRLPTHLELQYSKASLAEQWRAAFKRHNEELKKSLDINLEELFKKTGTVIK
Uniprot No.

Target Background

Database Links

KEGG: lpn:lpg0643

STRING: 272624.lpg0643

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant lpg0643 protein typically expressed and purified?

Recombinant lpg0643 protein is typically expressed in E. coli expression systems using a His-tag fusion for purification purposes . The recommended expression protocol includes:

  • Cloning the full-length gene (1-412 amino acids) into an expression vector with an N-terminal His-tag

  • Transforming the construct into an E. coli strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Inducing expression at lower temperatures (16-20°C) to enhance proper folding

  • Lysing cells using detergent-based methods compatible with membrane proteins

  • Purifying using nickel affinity chromatography followed by size exclusion chromatography

The protein is typically obtained as a lyophilized powder after purification and can be reconstituted in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, addition of 5-50% glycerol (with 50% being standard) and storage at -20°C/-80°C in aliquots is recommended to avoid repeated freeze-thaw cycles that may compromise protein integrity.

What experimental approaches are recommended for studying lpg0643 protein-protein interactions?

Several complementary approaches are recommended for investigating lpg0643 protein-protein interactions:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentifying interaction partners in native conditionsPreserves physiological contextMay miss transient interactions
Bacterial two-hybridScreening for potential interactorsHigh-throughput capabilityMay yield false positives
Cross-linking mass spectrometryCapturing direct interactionsCan identify interaction interfacesComplex data analysis
Surface plasmon resonanceMeasuring binding kineticsProvides quantitative dataRequires purified proteins
Proximity labeling (BioID)Identifying neighboring proteins in membraneWorks with membrane proteinsMay label proximal non-interactors

For membrane proteins like lpg0643, specialized approaches such as membrane yeast two-hybrid or in-cell cross-linking are particularly valuable as they account for the challenges posed by hydrophobic membrane-spanning domains.

When investigating potential interactions with host proteins, it's advisable to use both amoebae and human macrophage models given the documented host-specific adaptations of Legionella pneumophila . Comparative interactomics between different host environments may reveal host-specific protein partnerships.

How might lpg0643 contribute to host adaptation in Legionella pneumophila?

Host adaptation in Legionella pneumophila involves complex mechanisms that allow the bacterium to infect and reproduce in evolutionarily distant hosts. Experimental evolution studies have identified distinct mutational patterns when L. pneumophila is passaged through different host types .

Membrane proteins like lpg0643 could potentially contribute to host adaptation through several mechanisms:

  • Receptor recognition: The protein might interact with different host cell receptors, facilitating attachment or entry into specific host cell types

  • Membrane remodeling: It could participate in modification of the bacterial membrane composition in response to different host environments

  • Effector translocation: It might form part of secretion systems that deliver bacterial effectors into host cells

  • Nutrient acquisition: The protein could be involved in transport of host-specific nutrients or resources

  • Immune evasion: It might help the bacterium evade host-specific immune responses

Notably, experimental evolution studies have shown that mutations in LPS synthesis genes occurred only in lineages passaged with A. castellanii, whereas mutations in the LerC regulator occurred in lineages grown with U937 cells . This suggests that membrane-associated components are indeed important for host-specific adaptation. To determine if lpg0643 plays a similar role, comparative functional studies in both amoebic and human cell models would be necessary.

What are the challenges in obtaining functional recombinant lpg0643 protein and how can they be addressed?

Membrane proteins like lpg0643 present significant challenges for recombinant expression and purification. Key challenges and their potential solutions include:

  • Protein misfolding: Lower induction temperatures (16-18°C), specialized E. coli strains (C41/C43), and fusion partners (MBP, SUMO) can improve folding

  • Protein insolubility: Optimization of detergent screening is critical - start with mild detergents like DDM, LDAO, or C12E8 at concentrations just above CMC

  • Low expression levels: Consider codon optimization for E. coli and use strong inducible promoters with fine-tuned expression conditions

  • Protein aggregation: Include stabilizing agents (glycerol, specific lipids) in purification buffers and minimize freeze-thaw cycles

  • Functional assessment: Develop activity assays based on predicted function (transport activity, binding studies)

For lpg0643 specifically, reconstitution into lipid nanodiscs or proteoliposomes following purification may help maintain native conformation and activity. Given its potential role in host interaction, functional assays might include binding studies with host cell membrane fractions from both amoebic and human macrophage origins to detect potential host-specific interactions.

What methods are available for studying lpg0643 localization and topology in bacterial membranes?

Understanding the precise localization and topology of lpg0643 in bacterial membranes is crucial for functional characterization. Several methodological approaches are recommended:

  • Fluorescent protein fusions: Creating GFP/mCherry fusions at either N- or C-terminus to visualize localization through fluorescence microscopy

  • Immunogold electron microscopy: Using antibodies against lpg0643 with gold particle conjugation for high-resolution localization

  • Protease accessibility assays: Exposing intact bacteria or spheroplasts to proteases to determine which regions of the protein are exposed/protected

  • Reporter fusions for topology mapping: Creating fusions with reporters like PhoA (active in periplasm) or GFP (active in cytoplasm) at different positions

  • Cysteine scanning mutagenesis: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents

For analyzing potential transmembrane domains, combine experimental approaches with computational predictions using tools like TMHMM, Phobius, and TOPCONS. Based on the amino acid sequence, lpg0643 likely contains multiple transmembrane domains with intervening loops that may interact with host factors .

When designing these experiments, consider using both wild-type lpg0643 and variant forms identified in host-adapted strains if available, as topological changes might contribute to host-specific functions.

How can knockout or knockdown experiments be designed to study lpg0643 function?

To systematically study lpg0643 function through gene disruption approaches:

  • Complete gene knockout:

    • Use homologous recombination or CRISPR-Cas systems adapted for Legionella

    • Replace lpg0643 with a selectable marker (e.g., antibiotic resistance gene)

    • Confirm deletion by PCR and sequencing

    • Include complementation controls with wild-type lpg0643 to confirm phenotype specificity

  • Conditional knockdown:

    • Implement tetracycline-responsive promoter systems for titratable expression

    • Construct antisense RNA or CRISPRi systems for inducible knockdown

    • Monitor protein levels via western blotting with anti-His tag antibodies or custom antibodies

  • Domain-specific mutants:

    • Create targeted mutations in predicted functional domains

    • Generate truncations to identify essential regions

    • Introduce point mutations in conserved residues

  • Phenotypic assessment:

    • Evaluate growth rates in different media and temperature conditions

    • Test invasion and replication in both amoebic hosts and human macrophage models

    • Assess resistance to environmental stressors

    • Examine biofilm formation capacity

    • Measure competitive fitness against wild-type strains in mixed infections

When designing these experiments, it's important to consider potential genetic redundancy - other membrane proteins might compensate for lpg0643 loss. Additionally, phenotypes may only be apparent under specific conditions or in specific host systems, particularly given the host-specific adaptation patterns previously observed in Legionella pneumophila .

What cell models are most appropriate for studying lpg0643 function in host-pathogen interactions?

Based on current understanding of Legionella pneumophila biology, several cell models are suitable for investigating lpg0643 function in host-pathogen interactions:

Cell ModelAdvantagesSpecific ApplicationsKey Considerations
Acanthamoeba castellaniiNatural environmental hostEnvironmental persistence studiesCulture at 30°C, axenic medium
U937 human macrophage-like cellsModels human infectionPathogenesis studiesRequires differentiation with PMA
THP-1 human monocytesHuman-relevant modelInflammatory response studiesMore physiologically relevant than U937
Primary human alveolar macrophagesMost physiologically relevantValidating key findingsLimited availability, donor variability
Dictyostelium discoideumGenetically tractable amoebaMechanism studiesWell-defined genetics
Mouse bone marrow-derived macrophagesIn vivo relevanceLinks to animal modelsSpecies differences from human

A comparative approach using both protozoan (A. castellanii) and human cell models (U937) is highly recommended, as experimental evolution studies have demonstrated distinct adaptations to these different hosts . LPS modifications were observed specifically in A. castellanii-passaged strains, while mutations in the LerC regulator occurred in strains grown with U937 cells, highlighting the importance of testing multiple host systems.

For robust experimental design, infections should be performed in parallel across different host cell types under standardized conditions, with careful attention to bacterial growth phase, multiplicity of infection, and time points for assessment.

How should conflicting results regarding lpg0643 function be interpreted?

When encountering conflicting results about lpg0643 function, apply the following systematic approach to reconciliation:

  • Examine methodological differences:

    • Compare expression systems and tags used (N-terminal vs. C-terminal His-tags may affect function differently)

    • Assess differences in buffer compositions and purification protocols

    • Evaluate host cell models and infection conditions

    • Consider bacterial strain backgrounds (Philadelphia-1, Paris, Lens, etc.)

  • Consider context-dependent functions:

    • lpg0643 may have different roles depending on:

      • Growth phase (exponential vs. stationary)

      • Environmental conditions (temperature, pH, nutrient availability)

      • Host cell type (amoebic vs. human macrophage)

      • Infection stage (attachment, entry, intracellular replication, egress)

  • Evaluate experimental controls:

    • Assess complementation studies with wild-type protein

    • Verify protein expression levels in different systems

    • Check for polar effects in genetic studies

    • Confirm antibody specificity

  • Apply statistical rigor:

    • Ensure sufficient biological and technical replicates

    • Use appropriate statistical tests for data type

    • Consider effect sizes alongside p-values

    • Account for multiple testing corrections when appropriate

Experimental evolution studies have shown that Legionella pneumophila adapts differently to distinct host environments , suggesting that functional studies may yield different results depending on the host model used. When analyzing conflicting data, consider the possibility that lpg0643 may have evolved host-specific functions, similar to the observed host-specific mutations in LPS synthesis genes and the LerC regulator .

What bioinformatics approaches can help predict lpg0643 function?

Multiple bioinformatics approaches can provide valuable insights into potential lpg0643 functions:

  • Homology-based predictions:

    • BLAST searches against characterized protein databases

    • HMM-based searches for distant homologs using HMMER

    • Structural homology detection using HHpred or Phyre2

    • Ortholog identification across bacterial species using OrthoMCL

  • Structural predictions:

    • Secondary structure prediction (PSIPRED, JPred)

    • Transmembrane topology prediction (TMHMM, Phobius)

    • 3D structure prediction (AlphaFold2, RoseTTAFold)

    • Binding site prediction (3DLigandSite, COACH)

  • Functional inferences:

    • Gene neighborhood analysis across Legionella strains

    • Co-expression pattern analysis from transcriptomic data

    • Protein-protein interaction network analysis

    • Evolutionary rate analysis to identify selection patterns

  • Host-pathogen interaction predictions:

    • Identification of eukaryotic-like domains or motifs

    • Prediction of secretion signals

    • Analysis of surface-exposed regions

    • Identification of host-mimicry elements

Given that experimental evolution studies have identified host-specific adaptations in Legionella pneumophila , comparative genomic analyses comparing lpg0643 sequences across strains adapted to different hosts might provide particularly valuable insights. Variations in protein sequence or expression patterns between strains evolved in amoebae versus human macrophages could suggest functional specializations.

How could structural studies of lpg0643 inform new antimicrobial strategies?

Structural characterization of lpg0643 could significantly advance antimicrobial development strategies through several avenues:

  • Structure-based drug design:

    • High-resolution structures (X-ray crystallography or cryo-EM) could identify druggable pockets

    • Molecular dynamics simulations could reveal conformational flexibility important for function

    • Fragment-based screening against structural targets could identify initial chemical matter

    • Virtual screening campaigns against resolved structures could identify potential inhibitors

  • Functional surface mapping:

    • Identification of regions involved in host-pathogen interactions

    • Mapping of host-specific binding interfaces

    • Design of peptide inhibitors targeting key interaction surfaces

    • Development of antibodies targeting exposed epitopes

  • Comparative structural biology:

    • Comparing lpg0643 structures from strains adapted to different hosts could reveal host-specific structural adaptations

    • Structural comparisons with homologous proteins in other pathogens could identify conserved features for broad-spectrum targeting

    • Identification of structural features unique to Legionella could enable selective targeting

  • Therapeutic applications:

    • Design of small molecule inhibitors targeting essential functions

    • Development of peptide-based inhibitors that disrupt host-pathogen interactions

    • Creation of structural vaccines based on key epitopes

    • Engineering of targeted antimicrobial peptides

Recent EPA guidance on efficacy testing for antimicrobial products against Legionella pneumophila highlights the public health importance of developing new anti-Legionella strategies . If lpg0643 plays a role in host adaptation or virulence, structural insights could inform the development of novel antimicrobials that specifically target Legionella in building water systems, particularly cooling towers which have been implicated in multiple Legionnaires' disease outbreaks .

What are the most promising research directions for understanding lpg0643 in the context of Legionella host adaptation?

Several high-priority research directions could advance our understanding of lpg0643's role in Legionella host adaptation:

  • Comparative functional genomics:

    • Analyze lpg0643 sequence conservation and variation across Legionella strains isolated from different hosts

    • Conduct experimental evolution studies focusing specifically on lpg0643 changes

    • Perform transcriptomic analysis of lpg0643 expression in different host environments

    • Apply systems biology approaches to place lpg0643 in host-specific regulatory networks

  • Host-specific interaction studies:

    • Identify potential binding partners in both amoebic and human cellular models

    • Characterize binding kinetics and affinities for different host targets

    • Map interaction interfaces through mutagenesis and structural studies

    • Develop cell-based assays to measure interaction in living systems

  • In vivo significance assessment:

    • Create lpg0643 knockout and complemented strains

    • Compare fitness effects in different host models

    • Evaluate contribution to virulence in animal models

    • Assess competitive fitness in mixed infections

  • Mechanistic characterization:

    • Determine biochemical function (enzyme activity, transport, signaling)

    • Characterize structure-function relationships

    • Elucidate regulation of expression and activation

    • Develop high-throughput screening assays for inhibitor discovery

Building on findings from experimental evolution studies showing host-specific adaptations in Legionella , particularly interesting would be research investigating whether lpg0643 undergoes similar host-specific changes. The observation that mutations in LPS synthesis genes occurred specifically in amoeba-passaged strains while LerC regulator mutations appeared in human cell-adapted strains suggests a model where membrane components may play key roles in host adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.