Recombinant Legionella pneumophila UPF0761 membrane protein LPC_2650 (LPC_2650)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LPC_2650; UPF0761 membrane protein LPC_2650
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-412
Protein Length
full length protein
Species
Legionella pneumophila (strain Corby)
Target Names
LPC_2650
Target Protein Sequence
MNWKEKVKTKFYSCDRFVRFVIQHFIQDDCTYIASALAFTSLLAVVPLMSVGLAIFSSFP VFQGLAEPVQNFIFDNFVPATGKIVQSYLQQFTSQVSKLSIWGVVFLIFTALLVMFTIER AMNKIWRVSSSRHGVSAFLLYWAIISLAPVLLGLSLAASSYLFSMPILADHRAPYTILHY SPFFLSLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAKHAFAYYLIRYNTYELLYG AFATVPIFFIWVYWVWIITLLGAEISYAFSVHHQRRGGKSLDGFSHALLWLHQLWIAQQH GKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADGHYMLSRDLSHVTLYDLTQLL PYRLPTHLELQYSKASLSEQWRAAFKRHNEELKKSLDINLEELFKKTGTILK
Uniprot No.

Target Background

Database Links

KEGG: lpc:LPC_2650

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0761 membrane protein LPC_2650 in Legionella pneumophila?

LPC_2650 is a membrane protein belonging to the UPF0761 protein family in Legionella pneumophila. It consists of 412 amino acids with multiple predicted transmembrane domains, suggesting integration within the bacterial membrane. The protein is encoded by the LPC_2650 gene and has UniProt ID A5IGR4. As a protein with unknown function (UPF), its specific role in Legionella biology remains under investigation, though its membrane localization suggests potential involvement in pathogenesis or bacterial survival mechanisms .

How is recombinant LPC_2650 protein typically expressed and purified?

Recombinant LPC_2650 is commonly expressed in E. coli expression systems using the following methodological approach:

  • Cloning the full-length LPC_2650 gene (amino acids 1-412) into an expression vector with an N-terminal His-tag

  • Transformation into specialized E. coli strains optimized for membrane protein expression

  • Culture growth followed by induction under controlled temperature conditions

  • Cell harvest and lysis

  • Membrane fraction isolation

  • Solubilization using appropriate detergents

  • Affinity purification via the His-tag using nickel or cobalt resins

  • Additional purification steps as needed (size exclusion chromatography)

  • Quality assessment using SDS-PAGE to confirm >90% purity

The purified protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the optimal storage and handling conditions for recombinant LPC_2650?

For maximum stability and activity retention of recombinant LPC_2650 protein, researchers should follow these methodological guidelines:

Storage recommendations:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • For reconstituted protein, store working aliquots at 4°C for up to one week

  • For long-term storage after reconstitution, add glycerol to 30-50% final concentration and store at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as they compromise protein integrity

Handling protocol:

  • Briefly centrifuge the vial before opening to collect material at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow complete dissolution before use

  • For experiments requiring different buffers, consider gradual buffer exchange methods that maintain protein stability

What experimental approaches can be used to study LPC_2650 localization during Legionella infection?

Investigating the subcellular localization of LPC_2650 during infection requires sophisticated imaging and biochemical techniques:

Advanced imaging methodologies:

  • Immunofluorescence microscopy:

    • Develop and validate specific antibodies against LPC_2650

    • Fix infected cells at different time points post-infection

    • Co-stain with markers for various cellular compartments

    • Analyze using confocal or super-resolution microscopy

  • Live cell imaging with fluorescent fusion proteins:

    • Generate LPC_2650-fluorescent protein fusions (GFP, mCherry)

    • Validate that tagging doesn't disrupt protein function

    • Perform time-lapse imaging during infection

    • Track protein dynamics in real-time

  • Lattice Light Sheet Microscopy (LLSM):

    • Implement tailored approaches as described in recent studies

    • Utilize lower phototoxicity for extended imaging periods

    • Capture 4D (3D + time) data of protein dynamics

    • Analyze morphological signatures correlated with infection stages

Complementary biochemical approaches:

  • Subcellular fractionation of infected cells followed by western blotting

  • Proximity labeling techniques (BioID, APEX) to identify proteins near LPC_2650

  • Electron microscopy with immunogold labeling for ultrastructural localization

These combined approaches can reveal dynamic changes in LPC_2650 distribution throughout the Legionella infection cycle.

How can LLSM be optimized for studying LPC_2650 dynamics?

Optimizing Lattice Light Sheet Microscopy (LLSM) for LPC_2650 dynamics studies requires a comprehensive methodology with several technical considerations:

System optimization protocol:

  • Optical configuration:

    • Implement improved optical layout with path-stretching mirror sets

    • Integrate reconfigurable galvanometer scanner (RGS) module

    • Calibrate for optimal alignment and maintenance

  • Sample preparation:

    • Select appropriate host cells (macrophages or amoebae) for infection studies

    • Design optimal fluorescent tagging strategies for LPC_2650

    • Formulate media to minimize background fluorescence

    • Use chambered coverslips optimized for long-term imaging

  • Acquisition parameters:

    • Balance exposure time between signal quality and phototoxicity

    • Optimize Z-step size for accurate 3D reconstruction

    • Determine appropriate time intervals based on expected protein dynamics

    • Configure multi-channel acquisition for co-localization studies

  • Data processing workflow:

    • Apply deconvolution algorithms suitable for membrane proteins

    • Implement drift correction for extended imaging sessions

    • Perform bleaching correction as needed

    • Utilize 4D visualization techniques for comprehensive analysis

This tailored approach leverages LLSM's advantages for bacterial infection studies while minimizing photodamage, allowing for detailed characterization of LPC_2650 behavior during infection.

What challenges exist in expressing and purifying membrane proteins like LPC_2650 with proper folding?

Membrane proteins like LPC_2650 present specific challenges that require methodological solutions:

Expression challenges and solutions:

ChallengeMethodological Solution
Toxicity to expression hostsUse specialized E. coli strains (C41/C43, Lemo21); employ tightly regulated expression systems; optimize induction with lower temperatures (16-25°C)
Membrane insertion issuesCo-express with chaperones; supplement with specific lipids; consider eukaryotic expression systems for complex topologies
Low yieldOptimize codon usage; use strong but controllable promoters; test various induction parameters

Purification challenges and solutions:

ChallengeMethodological Solution
Effective solubilizationScreen multiple detergents (DDM, LMNG, GDN); optimize detergent concentration; consider novel solubilization approaches (nanodiscs, SMALPs)
Maintaining stabilityInclude stabilizing additives (glycerol, specific lipids); optimize buffer composition; minimize time at room temperature
Assessing proper foldingImplement thermal shift assays modified for membrane proteins; use limited proteolysis; verify function through binding assays if ligands are known

Detergent screening strategy:

DetergentWorking ConcentrationBest Applications
DDM0.01-0.05%General purpose initial screening
LMNG0.001-0.01%Enhanced stability for structural studies
Digitonin0.1-0.5%Preserving protein-protein interactions
GDN0.01-0.05%Crystallization and cryo-EM studies

These strategies can be systematically applied to optimize the production of properly folded LPC_2650 for structural and functional characterization .

How can site-directed mutagenesis be used to study functional domains within LPC_2650?

Site-directed mutagenesis provides a powerful approach to dissect structure-function relationships in LPC_2650:

Strategic mutagenesis methodology:

  • Target selection based on sequence analysis:

    • Identify conserved residues across Legionella species

    • Target predicted functional domains from bioinformatic analysis

    • Focus on charged residues in predicted transmembrane regions

    • Examine potential post-translational modification sites

  • Mutation design strategy:

    • Conduct alanine scanning of putative functional regions

    • Create conservative vs. non-conservative substitutions

    • Introduce or remove charged residues at key positions

    • Generate cysteine substitutions for accessibility studies

    • Develop deletion variants targeting specific domains

  • Experimental validation approach:

    • Analyze expression and localization of mutant proteins

    • Assess impact on bacterial growth and fitness

    • Measure effects on virulence in infection models

    • Identify altered interactions with host or bacterial proteins

Example mutation strategy for LPC_2650:

RegionTarget ResiduesMutation TypeRationaleFunctional Assessment Method
N-terminalK5, K8K→APotential surface interactionsMembrane localization analysis
TM1F20, V24F/V→AMembrane embeddingDetergent extraction efficiency
Loop regionsD45, N49D→N, N→DCharge modificationHost interaction assays
C-terminalL410, K412L→A, K→ATerminal interactionsProtein stability assessment

This systematic approach can identify critical residues for LPC_2650 function and provide insights into its role in Legionella pathogenesis.

What role might LPC_2650 play in antimicrobial resistance mechanisms in Legionella pneumophila?

Investigating LPC_2650's potential contribution to antimicrobial resistance requires examining several possible mechanisms:

Potential resistance-related functions:

  • Membrane permeability modulation:

    • As a membrane protein, LPC_2650 could affect antibiotic penetration

    • May influence membrane composition or fluidity

    • Could impact passive diffusion of antimicrobial compounds

  • Efflux system participation:

    • Possible component or regulator of efflux pump complexes

    • Potential interaction with known resistance systems like LpeAB

    • May contribute to substrate recognition or channel formation

  • Stress response and adaptation:

    • Potential role in membrane remodeling during antibiotic exposure

    • Possible involvement in signaling pathways related to stress response

    • May contribute to biofilm formation as a collective resistance mechanism

Experimental investigation methodology:

  • Gene expression analysis:

    • Measure LPC_2650 expression changes upon antibiotic challenge

    • Compare expression between resistant and sensitive strains

    • Correlate with expression of known resistance genes (ereA, lpeAB)

  • Genetic manipulation studies:

    • Generate LPC_2650 knockout or overexpression strains

    • Determine minimum inhibitory concentrations (MICs) for various antibiotics

    • Assess survival rates during antimicrobial exposure

    • Measure adaptation kinetics under antibiotic pressure

  • Structure-function analysis:

    • Identify structural similarities to known resistance-related proteins

    • Map membrane topology in relation to transport functions

    • Conduct protein-protein interaction studies with resistance factors

Understanding LPC_2650's relationship with known antimicrobial resistance mechanisms would contribute to comprehensive resistance profiling in Legionella pneumophila .

How does LPC_2650 expression vary across different Legionella pneumophila strains or serogroups?

Understanding LPC_2650 expression variation across strains provides insights into its potential role in strain-specific virulence:

Comparative analysis methodology:

  • Genomic sequence comparison:

    • Analyze LPC_2650 gene conservation across diverse strains

    • Identify polymorphisms or mutations in coding and regulatory regions

    • Examine promoter regions for potential regulatory differences

    • Construct phylogenetic relationships based on sequence variation

  • Expression profiling approach:

    • Perform RNA-Seq comparison across strains under identical conditions

    • Validate expression levels using quantitative RT-PCR

    • Analyze expression in different growth phases and environmental conditions

    • Examine expression changes during infection of host cells

  • Strain distribution analysis:

    • Compare expression between clinical and environmental isolates

    • Analyze across different serogroups (particularly serogroup 1 vs. others)

    • Correlate expression patterns with virulence phenotypes

Relevance to serogroup classification:
Legionella pneumophila is classified into multiple serogroups, with serogroup 1 (Lp1) being most frequently associated with human disease. Comparing LPC_2650 expression across these groups could reveal whether it contributes to the enhanced virulence observed in certain strains, similar to other virulence-associated genes like rtxA, enhC, and prpA documented in recent studies .

How can recombinant LPC_2650 be used in developing diagnostic tools for Legionella pneumophila detection?

Recombinant LPC_2650 offers potential for developing novel Legionella pneumophila diagnostic approaches:

Diagnostic development strategies:

  • Antibody-based detection systems:

    • Generate specific antibodies using purified recombinant LPC_2650

    • Develop ELISA or lateral flow immunoassays for rapid detection

    • Create immunofluorescence-based detection methods for environmental samples

    • Validate specificity across Legionella species and other bacteria

  • Nucleic acid-based detection:

    • Design PCR primers targeting the LPC_2650 gene

    • Develop multiplex PCR including LPC_2650 with established markers

    • Compare performance with existing molecular targets like mip and wzm

    • Optimize for various sample types (clinical specimens, water systems)

  • Diagnostic performance evaluation:

    • Determine sensitivity and specificity metrics

    • Compare with gold standard culture methods

    • Validate across diverse sample types

    • Assess in the context of other established markers

Comparative diagnostic marker assessment:

MarkerAdvantagesLimitationsOptimal Applications
LPC_2650Membrane protein stabilitySpecificity requires validationEnvironmental monitoring
mip geneWell-established targetPotential cross-reactivityClinical diagnosis
wzm geneSerogroup 1 specificMisses other serogroupsOutbreak investigation
Multi-target panelEnhanced specificityHigher complexityConfirmatory testing

Recent research has demonstrated the value of molecular methods targeting specific genes for rapid and reliable Legionella detection . Incorporating LPC_2650 into such approaches could enhance diagnostic accuracy or provide complementary information to existing methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.