Recombinant Leifsonia xyli subsp. xyli ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Leifsonia xyli subsp. xyli is a Gram-positive bacterium that causes ratoon stunting disease in sugarcane, leading to significant yield losses . The ATP synthase subunit b (atpF) is a component of the F1F0 ATP synthase, an enzyme that produces ATP from ADP using a proton or sodium gradient . The recombinant form of this protein is produced using genetic engineering techniques, often in E. coli expression systems, for research and industrial applications .

Protein Information

The atpF gene encodes the ATP synthase subunit b protein . The protein is a component of the F1F0 ATP synthase, which is essential for energy production in bacteria .

Table 1: Key Details of Leifsonia xyli subsp. xyli ATP synthase subunit b (atpF)

FeatureDescription
Recommended NameATP synthase subunit b
Alternative NamesATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
Gene NameatpF
Ordered Locus NameLxx07010
OrganismLeifsonia xyli subsp. xyli (strain CTCB07)
UniProt IDQ6AG62
Amino Acid Length190
SequencemLSSVVIAASEEQHNPLIPEPADIVGSLICFVVILFFFWKLVLPRVKKLLDERAEAIEGNIAKADEAQHKAEALLEEYTAQLAEARADAAKIREQARTDGQKIVAEAKDTAT AEAARVTASAQAQIEAERQTALVSLRGEVGSLAIDIASGVVGEVLTEDKKAQAIVDRFLADLEASEKATSNEKAGTAN
Expression Region1-190
Molecular WeightApproximately 21 kDa (estimated from amino acid sequence)

Production of Recombinant atpF

Recombinant Leifsonia xyli subsp. xyli ATP synthase subunit b (atpF) is typically produced in E. coli expression systems . The gene encoding atpF is cloned into an expression vector and transformed into E. coli cells. The expression of the protein is then induced, leading to the production of recombinant atpF.

Table 2: Production Details

FeatureDescription
Expression SystemIn vitro E. coli expression system
Tag InfoDetermined during production process
PurityHigh purity

Applications

Recombinant Leifsonia xyli subsp. xyli ATP synthase subunit b (atpF) has several research and potential industrial applications:

  1. Enzyme-Linked Immunosorbent Assays (ELISA): Recombinant atpF can be used as an antigen in ELISA to detect antibodies against Leifsonia xyli subsp. xyli . This is useful for diagnosing ratoon stunting disease in sugarcane.

  2. Structural Studies: The recombinant protein can be used for structural studies to understand the function and mechanism of ATP synthase .

  3. Drug Discovery: atpF is a potential target for developing new antimicrobial agents against Leifsonia xyli subsp. xyli. The recombinant protein can be used in drug screening assays.

  4. Studies of Phylogenetic Relationships: The atpF gene, along with other genes such as atpD, gyrB, ppk, recA, and rpoB, are used in phylogenetic studies to analyze the genetic relatedness among different bacterial species .

  5. Detection Assays: Recombinant atpF may assist in the development of detection assays for Leifsonia xyli subsp. xyli .

Research Findings

  1. Phylogenetic Analysis: Studies have used the atpF gene to analyze the genetic relationships among members of the Clavibacter genus . The atpF sequence of Leifsonia xyli subsp. xyli is used as a reference for comparison.

  2. Genome Sequencing: The genome sequence of Leifsonia xyli subsp. xyli has been determined, providing valuable information for understanding the bacterium's biology and pathogenicity . The atpF gene is annotated in the genome.

  3. Detection Methods: Researchers have developed methods for rapid detection of Leifsonia xyli subsp. xyli, such as modified loop-mediated isothermal amplification (LAMP) assays . These methods are essential for managing ratoon stunting disease in sugarcane.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Lxx07010; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Leifsonia xyli subsp. xyli (strain CTCB07)
Target Names
atpF
Target Protein Sequence
MLSSVVIAASEEQHNPLIPEPADIVGSLICFVVILFFFWKLVLPRVKKLLDERAEAIEGN IAKADEAQHKAEALLEEYTAQLAEARADAAKIREQARTDGQKIVAEAKDTATAEAARVTA SAQAQIEAERQTALVSLRGEVGSLAIDIASGVVGEVLTEDKKAQAIVDRFLADLEASEKA TSNEKAGTAN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Leifsonia xyli subsp. xyli and why is its ATP synthase subunit b important for research?

Leifsonia xyli subsp. xyli is a gram-positive bacterium that functions as the causal agent of ratoon stunting disease in sugarcane crops . The ATP synthase subunit b (atpF) is a critical component of the bacterial F-type ATP synthase complex, which plays a central role in energy metabolism. This protein, encoded by the atpF gene (locus name Lxx07010), is essential for the assembly and function of the ATP synthase complex .

Research on this protein contributes to our understanding of bacterial energy metabolism, potential antimicrobial targets, and the pathogenicity mechanisms of Leifsonia xyli. The availability of recombinant forms of this protein enables detailed biochemical and structural studies that would otherwise be challenging due to the fastidious nature of this plant pathogen .

How does the recombinant atpF protein differ from the native form?

The recombinant Leifsonia xyli subsp. xyli ATP synthase subunit b is produced in expression systems rather than isolated from the native organism. This offers several advantages for research purposes:

  • Tag addition: The recombinant protein may include affinity tags that facilitate purification and detection. The specific tag type is determined during the production process .

  • Expression region optimization: The recombinant protein typically contains the expression region 1-190, which corresponds to the full-length protein .

  • Buffer optimization: The recombinant protein is supplied in a stabilized buffer (Tris-based with 50% glycerol) specifically optimized for this protein .

  • Purity and concentration: Recombinant production allows for higher purity and defined concentration (typically available as 50 μg quantities), enabling more consistent and reproducible experimental results .

The biological activity of properly folded recombinant atpF should theoretically match the native protein, though researchers should validate this through appropriate functional assays for their specific experimental applications.

What methodologies are recommended for studying ATP synthase function using recombinant atpF?

For functional studies of ATP synthase using recombinant atpF, several methodologies can be employed:

  • Reconstitution Studies: The recombinant atpF can be used in reconstitution experiments with other ATP synthase subunits to study complex assembly and function. This typically involves:

    • Combining purified subunits in appropriate buffers

    • Monitoring ATP synthesis/hydrolysis activities

    • Analyzing proton translocation across membranes

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Surface plasmon resonance to measure binding kinetics

    • FRET-based approaches to study subunit interactions in real-time

  • Structure-Function Analysis:

    • Site-directed mutagenesis of conserved residues

    • Circular dichroism spectroscopy to assess secondary structure changes

    • Thermal shift assays to evaluate protein stability

  • Metabolic Flux Analysis:

    • Integration with genome-scale metabolic models to predict energetic impacts

    • Isotope labeling experiments to track ATP synthesis rates

    • Comparative analysis with other bacterial ATP synthases

These methodologies can be complemented by computational approaches similar to those used in metabolic switch studies of related bacterial species, where flux balance analysis can reveal the role of energy metabolism in bacterial adaptation .

How can researchers use recombinant atpF for studying bacterial pathogenicity mechanisms?

Researching bacterial pathogenicity using recombinant atpF can be approached through several experimental designs:

  • Antibody Development:

    • Generate antibodies against recombinant atpF for immunolocalization studies

    • Use antibodies to track ATP synthase distribution during infection processes

    • Develop immunodiagnostic tools for detecting Leifsonia xyli in plant samples

  • Interaction with Host Factors:

    • Analyze potential interactions between atpF and host proteins

    • Study how energy metabolism changes during host colonization

    • Examine if ATP synthase components are exposed to host immune recognition

  • Comparative Genomics and Proteomics:

    • Compare atpF sequences across pathogenic and non-pathogenic strains

    • Analyze conservation patterns to identify functionally important regions

    • Correlate variations with differences in virulence or host specificity

  • Metabolic Modeling:

    • Incorporate ATP synthase function into genome-scale metabolic models

    • Simulate energy requirements during different infection stages

    • Predict metabolic vulnerabilities that could be targeted to control infection

A comprehensive approach would include comparing metabolic switches similar to those studied in Streptomyces species, where reorganization of metabolism is linked to different growth phases and production of secondary metabolites .

What are the appropriate expression systems and purification strategies for obtaining high-quality recombinant atpF?

Producing high-quality recombinant Leifsonia xyli subsp. xyli ATP synthase subunit b requires careful selection of expression systems and purification strategies:

Expression Systems:

Expression SystemAdvantagesChallengesRecommended Use Cases
E. coliFast growth, high yields, well-established protocolsPotential inclusion body formationInitial structural studies, antibody production
Bacillus subtilisGram-positive background, better folding for some proteinsLower yields than E. coliFunctional studies requiring native-like folding
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, smaller scaleProteins toxic to host cells, rapid screening

Purification Strategy:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Ion exchange chromatography based on theoretical pI

    • Ammonium sulfate precipitation as an alternative first step

  • Intermediate Purification:

    • Size exclusion chromatography to separate monomers from aggregates

    • Hydrophobic interaction chromatography

  • Final Polishing:

    • Second ion exchange step at different pH

    • Removal of affinity tags if present and required

  • Storage Considerations:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, maintain at -80°C

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

The purification strategy should be validated using SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity and purity.

How can researchers utilize the structural data of atpF in drug discovery targeting Leifsonia xyli?

The computational structure model of ATP synthase subunit b from Leifsonia xyli provides valuable insights for structure-based drug discovery approaches:

  • Binding Site Identification:

    • Analyze the protein structure using computational tools to identify potential binding pockets

    • Focus on regions with high confidence scores (pLDDT > 70) in the AlphaFold model

    • Compare binding sites with homologous proteins to identify unique features

  • Virtual Screening Workflow:

    • Prepare the protein structure (AF_AFQ6AG62F1) for docking studies

    • Select appropriate compound libraries (antimicrobial-focused or diverse sets)

    • Employ molecular docking to identify potential inhibitors

    • Refine hits through molecular dynamics simulations

  • Fragment-Based Approaches:

    • Screen fragment libraries against specific domains of the protein

    • Use nuclear magnetic resonance (NMR) or X-ray crystallography to validate binding

    • Link or grow fragments into lead compounds

  • Peptide Inhibitor Design:

    • Design peptides that can disrupt the interaction between atpF and other ATP synthase subunits

    • Target the interfaces critical for complex assembly

    • Optimize peptides for stability and cell penetration

The relatively high global confidence score (pLDDT 88.45) of the AlphaFold model suggests that structure-based approaches would be reasonably reliable, though experimental validation remains essential.

What are the optimal conditions for storage and handling of recombinant atpF to maintain activity?

To maintain optimal activity of recombinant Leifsonia xyli ATP synthase subunit b, follow these evidence-based storage and handling protocols:

  • Storage Recommendations:

    • Long-term storage: -20°C or -80°C in Tris-based buffer with 50% glycerol

    • Working aliquots: 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can lead to protein denaturation

  • Buffer Considerations:

    • Standard buffer: Tris-based buffer with 50% glycerol at pH 7.5-8.0

    • For functional assays: Consider including magnesium ions (1-5 mM) as they are essential for ATP synthase function

    • For structural studies: Add reducing agents like DTT or β-mercaptoethanol (1-5 mM) to prevent disulfide formation

  • Handling Best Practices:

    • Thaw frozen protein samples on ice

    • Centrifuge briefly after thawing to collect contents

    • Use low-retention tubes and pipette tips to minimize protein loss

    • When diluting, use buffers pre-equilibrated to the same temperature

  • Stability Considerations:

    • Membrane proteins like atpF often have hydrophobic regions that can lead to aggregation

    • Consider adding mild detergents for assays requiring exposure of hydrophobic domains

    • Monitor protein stability using dynamic light scattering or thermal shift assays

These recommendations are derived from standard practices for similar membrane-associated proteins and the specific information provided for this recombinant protein .

What are the key considerations for developing antibodies against Leifsonia xyli atpF?

Developing effective antibodies against Leifsonia xyli ATP synthase subunit b requires careful planning:

  • Epitope Selection Strategy:

    • Analyze the amino acid sequence (190 residues) to identify regions with high antigenicity

    • Target surface-exposed regions based on the AlphaFold structural model

    • Avoid transmembrane regions which may have poor immunogenicity

    • Consider the following epitope candidates based on sequence analysis:

RegionAmino Acid SequencePredicted LocationAntigenicity Score
30-45RVKKLDERAEAIEGNSurface loopHigh
100-115TDGQKIVAEAKDTATPeripheral regionMedium-High
160-175DIASGVVGEVLTEDKKExposed domainMedium
  • Antibody Production Approaches:

    • Polyclonal antibodies: Immunize rabbits with full-length recombinant protein

    • Monoclonal antibodies: Use selected peptide epitopes conjugated to carrier proteins

    • Recombinant antibodies: Screen phage display libraries against the purified protein

  • Validation Methods:

    • Western blotting against recombinant protein and bacterial lysates

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence microscopy to confirm specificity

    • ELISA to determine antibody titer and affinity

  • Potential Challenges:

    • Cross-reactivity with ATP synthase from other bacterial species

    • Limited accessibility of certain epitopes in the native complex

    • Conformational changes between recombinant and native protein forms

The inclusion of proper controls (pre-immune serum, isotype controls) and validation across multiple experimental approaches is essential for ensuring antibody specificity and utility.

How can researchers validate the functional activity of recombinant atpF?

Validating the functional activity of recombinant Leifsonia xyli ATP synthase subunit b requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Size exclusion chromatography to confirm proper oligomeric state

    • Thermal shift assays to evaluate protein stability

  • Binding and Assembly Assays:

    • Pull-down assays with other ATP synthase subunits to verify interaction capability

    • Native PAGE to assess complex formation

    • Biolayer interferometry or surface plasmon resonance to measure binding kinetics

  • Functional Complementation:

    • Expression in atpF-deficient bacterial strains to assess rescue of phenotype

    • Measurement of ATP synthesis activity in reconstituted proteoliposomes

    • Proton translocation assays using pH-sensitive fluorescent dyes

  • Activity Comparison Table:

Assay TypePrincipleExpected ResultControls
ATP SynthesisReconstitute with other subunits, measure ATP productionATP production correlating with protein concentrationHeat-inactivated protein
Proton TranslocationMonitor pH changes across membranespH gradient formationUncoupler addition to collapse gradient
Thermal StabilityDifferential scanning fluorimetryIncreased stability in presence of binding partnersIndividual subunits alone

These validation approaches should be complemented by comparative analysis with ATP synthase components from related organisms to establish evolutionary conservation of function, similar to the systems biology approaches used in metabolic network studies .

How can atpF be utilized in synthetic biology applications?

The ATP synthase subunit b from Leifsonia xyli offers several innovative applications in synthetic biology:

  • Engineered Energy Systems:

    • Incorporation into artificial membrane systems for ATP production

    • Coupling with light-harvesting complexes to create light-driven ATP synthesis

    • Development of hybrid energy-generating modules combining components from different organisms

  • Biosensor Development:

    • Creation of sensors for proton gradient detection

    • Engineering reporter systems linked to ATP synthase assembly

    • Development of whole-cell biosensors for antimicrobials targeting energy metabolism

  • Protein Scaffold Applications:

    • Utilizing the structural properties of atpF as a scaffold for organizing other proteins

    • Engineering synthetic protein complexes that leverage the natural assembly properties

    • Creating chimeric proteins with novel functions based on atpF structural framework

  • Metabolic Engineering Integration:

    • Optimizing energy production in engineered metabolic pathways

    • Creating organisms with modified energy conversion efficiency

    • Integrating with genome-scale metabolic models to predict system-wide effects

This approach parallels the systems biology frameworks used to study metabolic switches in bacteria, where computational models integrate multiple levels of biological information to predict metabolic behaviors .

What comparative insights can be gained by studying atpF across different bacterial species?

Comparative analysis of ATP synthase subunit b across bacterial species provides valuable evolutionary and functional insights:

  • Evolutionary Conservation Patterns:

    • Identification of core conserved residues essential for function

    • Mapping of species-specific variations that may relate to ecological adaptations

    • Reconstruction of the evolutionary history of ATP synthase components

  • Structure-Function Relationship:

    • Correlation between structural variations and functional differences

    • Identification of species-specific features that could be exploited for selective targeting

    • Understanding how structural variations impact ATP synthesis efficiency

  • Adaptation to Environmental Niches:

    • Analysis of how ATP synthase components vary in extremophiles

    • Correlation between habitat and energy coupling mechanisms

    • Identification of adaptive variations in pathogenic versus free-living bacteria

  • Comparative Analysis Table:

FeatureLeifsonia xyli atpFE. coli atpFMycobacterial atpFFunctional Implication
Length190 amino acids156 amino acids170-180 amino acidsDifferent stalk lengths affect rotational mechanics
Hydrophobic regionsModerateLowerHigherMembrane interaction differences
Conservation level-45-55% identity50-60% identityCore functional domains preserved
Unique motifsC-terminal extensionN-terminal differencesMycobacteria-specific insertionsPotential species-specific interactions

This comparative approach aligns with the metabolic modeling methodologies used to identify broader patterns across bacterial species, as described in genomic studies of actinomycetes .

What is the role of atpF in the Leifsonia xyli life cycle and pathogenicity?

The ATP synthase subunit b likely plays multiple crucial roles in Leifsonia xyli's life cycle and pathogenicity:

  • Energy Production During Infection:

    • ATP synthase functions as the primary energy production machinery during host colonization

    • The efficiency of ATP synthesis may directly impact virulence and persistence

    • Environmental changes in the host may require adaptation of energy metabolism

  • Adaptation to Host Environment:

    • Changes in pH, nutrient availability, and oxygen levels in plant tissues require metabolic adaptation

    • ATP synthase regulation may be critical during the transition from saprophytic to pathogenic lifestyle

    • Similar to the metabolic switch observed in Streptomyces species, Leifsonia likely undergoes metabolic reorganization during infection

  • Potential Role in Biofilm Formation:

    • Energy availability impacts biofilm formation and maintenance

    • ATP synthase function may be differentially regulated in planktonic versus biofilm states

    • Energy metabolism shifts may signal developmental transitions

  • Interactions with Host Immunity:

    • Bacterial ATP synthase components may be recognized by plant immune receptors

    • Energy metabolism adaptations may help evade host defense responses

    • ATP generation capacity directly impacts stress resistance mechanisms

Understanding these roles requires integration of multiple experimental approaches, including transcriptomics, proteomics, and metabolic modeling similar to approaches used to study metabolic switches in related bacterial species .

What are the key considerations for designing experiments to study atpF in the context of Leifsonia xyli infection?

Designing robust experiments to investigate ATP synthase subunit b during Leifsonia xyli infection requires careful planning:

  • Host-Pathogen Model Systems:

    • Develop appropriate sugarcane tissue culture models for controlled infection

    • Consider micropropagated plants for reproducible infection studies

    • Establish quantifiable disease progression metrics

  • Gene Expression Analysis:

    • Design qRT-PCR primers specific to atpF and other ATP synthase genes

    • Plan time-course experiments to capture expression changes during infection

    • Include appropriate reference genes validated for stability during infection

  • Protein Localization Studies:

    • Develop immunolocalization protocols using antibodies against recombinant atpF

    • Consider fluorescent protein fusions for live cell imaging

    • Plan co-localization studies with host cellular markers

  • Functional Studies Framework:

Research QuestionExperimental ApproachControlsAnalysis Method
Is atpF expression altered during infection?RNA-seq, qRT-PCRMock-infected plants, housekeeping genesDifferential expression analysis
Does atpF localization change during infection?Immunofluorescence, EM immunogoldPre-immune sera, non-infected tissuesQuantitative image analysis
Does ATP synthesis rate affect virulence?Engineered strains with modified atpF expressionWild-type strain, complemented mutantsDisease severity quantification
Can atpF be targeted to reduce infection?ATP synthase inhibitor treatmentVehicle-only treatment, non-specific inhibitorsDose-response analysis

These experimental approaches should be integrated with metabolic modeling similar to methods employed in studying metabolic switches in other bacteria , allowing for predictions of energy requirements during different infection stages.

How can researchers integrate atpF studies with systems biology approaches?

Integrating ATP synthase subunit b research into systems biology frameworks enables comprehensive understanding of its role:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to track ATP synthase regulation

    • Develop correlation networks to identify genes co-regulated with atpF

    • Use multi-omics data to constrain flux balance analysis models

  • Genome-Scale Metabolic Modeling:

    • Incorporate ATP synthase function into genome-scale metabolic models

    • Simulate energy metabolism under different conditions

    • Predict metabolic consequences of atpF mutations or inhibition

    • Apply approaches similar to those used for metabolic switch analysis in related bacteria

  • Network Analysis:

    • Place ATP synthase in the context of protein-protein interaction networks

    • Identify regulatory networks controlling energy metabolism

    • Study topological features of metabolic networks involving ATP production and consumption

  • Integration Framework:

Data TypeIntegration MethodExpected InsightComputational Tool
TranscriptomicsDifferential expression, co-expression networksRegulatory patterns of ATP synthase genesDESeq2, WGCNA
ProteomicsProtein complex analysis, PTM identificationATP synthase assembly, regulationSTRING, DAVID
MetabolomicsFlux analysis, metabolite profilingEnergy metabolism outputsCOBRA Toolbox
Structural BiologyMolecular dynamics, protein-protein dockingMolecular mechanisms of ATP synthase functionGROMACS, HADDOCK

This systems-level approach parallels methodologies used to study metabolic networks in actinomycetes, where genome-scale models have revealed important metabolic trends across species .

What are the emerging research directions involving bacterial ATP synthase and potential applications for Leifsonia xyli atpF?

The study of Leifsonia xyli ATP synthase subunit b represents a developing area with several promising research directions:

  • Antimicrobial Development:

    • ATP synthase is an underexplored target for novel antimicrobials

    • Bacterial-specific features of atpF could enable selective targeting

    • Rational design of inhibitors based on structural models offers promising approaches

  • Agricultural Applications:

    • Development of diagnostic tools for early detection of Leifsonia infection

    • Creation of resistant sugarcane varieties through genetic engineering

    • Design of targeted treatments for ratoon stunting disease

  • Fundamental Energy Biology:

    • Understanding specializations of ATP synthase in plant pathogens

    • Elucidating the role of energy metabolism in host-pathogen interactions

    • Exploring evolutionary adaptations in bacterial energy generation systems

  • Biotechnological Applications:

    • Engineering ATP synthase components for improved bioenergetic applications

    • Development of biosensors based on ATP synthase assembly

    • Creation of minimal synthetic systems for energy production

These research directions can benefit from integrative approaches combining structural biology, biochemistry, genetics, and systems biology, similar to the computational frameworks used to study metabolic networks in actinomycetes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.