Recombinant Leifsonia xyli subsp. xyli Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of LspA

Gene and protein details

  • Gene locus: Lxx15175 in Leifsonia xyli subsp. xyli (strain CTCB07) .

  • Protein: Lipoprotein signal peptidase (SPase II), EC 3.4.23.36, with a molecular weight of 24.8 kDa and isoelectric point (pI) of 5.01 .

  • Sequence: Comprises 216 amino acids (positions 1–216), featuring a conserved RskA family domain and a transmembrane region (residues 92–114) .

Key findings from homolog studies:

  • In Rickettsia typhi, LspA overexpression in E. coli conferred globomycin resistance and restored growth in temperature-sensitive mutants, confirming its functional role in lipoprotein maturation .

  • Despite low sequence identity (22%) with E. coli LspA, Leifsonia LspA retains conserved catalytic residues, enabling partial complementation in heterologous systems .

Recombinant Production and Applications

Expression and purification:

  • Recombinant LspA is produced in E. coli with a Tris-based storage buffer (50% glycerol) and optimized for stability at -20°C .

Diagnostic utility:

  • Used in enzyme-linked immunosorbent assays (ELISA) for detecting Leifsonia xyli infections in sugarcane, leveraging its antigenic properties .

  • High-purity preparations (1.0–2.0 µg/µL) enable sensitive detection of bacterial titers in plant xylem sap .

Comparative Analysis with Other Signal Peptidases

FeatureLspA (Leifsonia)LspA (E. coli)LepB (SPase I)
FunctionLipoprotein processingLipoprotein processingNon-lipoprotein secretion
Expression levelModerateHighHigh
EssentialityCritical for virulenceEssential for growthEssential for Sec pathway
Inhibitor sensitivityGlobomycin-sensitiveGlobomycin-sensitiveNot applicable

Data synthesized from .

Research Gaps and Future Directions

  • Mechanistic studies: The exact role of LspA in Leifsonia virulence remains uncharacterized, warranting knockout experiments.

  • Structural biology: No crystallographic data exists for Leifsonia LspA; resolving its 3D structure could aid inhibitor design.

  • Agricultural applications: Development of LspA-targeted diagnostics could improve screening for resistant sugarcane cultivars .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary based on the purchase method and location. Kindly consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
lspA; Lxx15175; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Leifsonia xyli subsp. xyli (strain CTCB07)
Target Names
lspA
Target Protein Sequence
MATSRTAPTRAPSLRSSPALEASPSRTKASVGALVILAVVALCVYLMDQITKALVVSNLS EGQQVAVLGQLLQLHFVKNPGAAFSIGSGSTWIFSLVGVGVLGFVIWYAPRIRSTAWAIL FGLLLGGLLGNLTDRLFREPGFGVGHVIDFLQIPLLTAIFNLADVAIVFSMGLFLLLTLR GIGLDGRRQRDEGAGVSSASPAGDESAADKPENLSA
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does LspA contribute to bacterial cell envelope integrity?

LspA processes prolipoproteins, which are important structural and functional components of bacterial cell envelopes. After processing by LspA, mature lipoproteins properly localize to the cell envelope where they perform various functions including:

  • Maintaining cell envelope architecture

  • Participating in nutrient acquisition

  • Contributing to antibiotic resistance mechanisms

  • Supporting bacterial pathogenesis

In LspA mutants of Staphylococcus aureus, for example, improper lipoprotein processing leads to reduced survival in human blood, indicating the importance of this enzyme for bacterial viability under stress conditions . While the specific functions of Leifsonia xyli lipoproteins are not detailed in the search results, the conservation of LspA across bacterial species suggests a similar critical role in cell envelope integrity.

What are the structural characteristics of LspA enzymes?

Based on crystal structure studies of LspA from Staphylococcus aureus, LspA typically consists of:

  • Four transmembrane helices (H1-H4)

  • Catalytic dyad aspartates (Asp118 and Asp136) located toward the membrane's outer surface

  • A β-cradle, a hemi-cylindrically shaped sheet that sits on the membrane and accommodates substrate binding

  • An extracellular loop (EL) between strand 2 (S2) in the β-cradle and H2 that shows flexibility important for substrate binding

The enzyme structure includes highly conserved residues that cluster around the active site and substrate binding pocket. While the specific structure of Leifsonia xyli LspA has not been determined based on the search results, bacterial LspA enzymes typically share conserved structural features that are essential for their function.

How do the inhibitors globomycin and myxovirescin interact with LspA, and what implications does this have for research on Leifsonia xyli LspA?

Globomycin and myxovirescin are two natural antibiotics that inhibit LspA through convergent evolution. Despite having different molecular structures, they inhibit LspA identically as non-cleavable tetrahedral intermediate analogs:

  • Both inhibitors position a hydroxyl group between the catalytic dyad aspartates, mimicking the tetrahedral intermediate in peptide bond hydrolysis

  • They share a common "spine" of 19 contiguous atoms that superpose along the substrate binding site

  • The two antibiotics interact with the enzyme through different conformations of the extracellular loop (EL), highlighting the importance of EL flexibility for inhibitor binding

For researchers working with Leifsonia xyli LspA, these inhibitors could serve as valuable tools for:

  • Confirming the functional identity of recombinant LspA through inhibition assays

  • Probing the active site architecture by comparing inhibition profiles with well-characterized LspA enzymes

  • Developing structure-activity relationships that could inform antimicrobial development against Leifsonia xyli

Researchers could employ dose-response inhibition assays similar to those used for S. aureus LspA, where IC50 values were determined using both gel-shift and FRET-based activity assays .

What experimental approaches can be used to study the catalytic mechanism of recombinant Leifsonia xyli LspA?

Multiple complementary approaches can be employed:

  • Site-directed mutagenesis: Target conserved catalytic residues (likely Asp118 and Asp136 based on homology) to confirm their role in catalysis. In S. aureus LspA, mutating these residues led to complete loss of enzyme activity .

  • Enzyme kinetics analysis:

    • FRET-based assays using synthetic lipopeptide substrates to determine kinetic parameters (Km and Vmax)

    • Gel-shift assays using recombinant prolipoproteins to monitor processing in a more native context

    • Comparison of kinetic parameters with LspA from other species (e.g., S. aureus LspA showed Km = 47 μM and Vmax = 2.5 nmol/(mg min) in FRET assays)

  • Structural studies:

    • X-ray crystallography of LspA alone or in complex with inhibitors

    • Molecular dynamics simulations to study binding interactions and conformational changes

  • Inhibitor binding studies:

    • IC50 determination for globomycin and myxovirescin

    • Thermal shift assays to measure stabilization upon inhibitor binding

A comparison table of methodologies could be structured as follows:

MethodTechnical DifficultyInformation GainedRequired Resources
Site-directed mutagenesisModerateIdentification of catalytic residuesMolecular biology lab, expression system
FRET-based enzyme assaysModerateKinetic parametersFluorescence plate reader, synthetic substrate
Gel-shift assaysModerateProcessing of native substratesGel electrophoresis, recombinant substrate
X-ray crystallographyHighAtomic-level structureProtein crystallization facility, synchrotron access
Inhibitor binding studiesModerateMechanism of inhibitionPurified enzyme, inhibitors

How can researchers optimize the expression and purification of recombinant Leifsonia xyli LspA for structural and functional studies?

Optimizing expression and purification typically involves:

  • Expression system selection:

    • E. coli is commonly used, as seen with the Lactobacillus sakei LspA

    • Consider membrane protein expression strains (e.g., C41/C43) due to LspA's transmembrane domains

    • Evaluate different fusion tags (His-tag is common and was used successfully for S. aureus LspA)

  • Expression optimization:

    • Test different induction conditions (temperature, inducer concentration, time)

    • Consider auto-induction media for membrane proteins

    • Evaluate different cell compartment targeting strategies

  • Membrane protein extraction:

    • Screen detergents for optimal solubilization (LMNG was used successfully for S. aureus LspA)

    • Consider using styrene-maleic acid copolymer (SMA) for native-like lipid nanodisc extraction

  • Purification strategy:

    • Implement a multi-step purification scheme (affinity chromatography followed by size exclusion)

    • Incorporate a tag removal step if needed for functional assays or crystallization

    • Maintain detergent above critical micelle concentration throughout purification

  • Protein quality assessment:

    • Size exclusion chromatography to confirm monodispersity

    • Circular dichroism to verify secondary structure content

    • Activity assays to confirm functionality after purification

    • Thermal stability assays to optimize buffer conditions

Based on the approach used for Lactobacillus sakei LspA, the recombinant protein can be stored as a lyophilized powder and reconstituted in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. Adding glycerol (final concentration 5-50%) to aliquots is recommended for long-term storage at -20°C/-80°C .

What assays can be used to measure LspA activity, and how should they be optimized for Leifsonia xyli LspA?

Several complementary assays can be employed:

  • Gel-shift assay:

    • A coupled assay where a recombinant prolipoprotein (e.g., proICP) is first lipidated by Lgt, then processed by LspA

    • The processing is visualized by SDS-PAGE, with prolipoprotein and processed lipoprotein showing different migration patterns

    • For optimization, use the following conditions as starting points:

      • 12 μM prolipoprotein substrate

      • 250 μM phospholipid (e.g., DOPG)

      • 1.2 μM Lgt for lipidation

      • 0.5 μM LspA

      • Buffer containing 50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 0.02% LMNG

  • FRET-based assay:

    • Uses synthetic lipopeptide substrates with fluorophore/quencher pairs

    • Peptide cleavage separates the fluorophore and quencher, resulting in increased fluorescence

    • Enables real-time monitoring and precise kinetic measurements

    • Requires custom peptide synthesis with appropriate modifications

  • Inhibition assays:

    • Measure IC50 values for known LspA inhibitors like globomycin and myxovirescin

    • Can be performed with either gel-shift or FRET-based methods

    • For tight-binding inhibitors, IC50 values may approach enzyme concentration

When optimizing for Leifsonia xyli LspA, consider:

  • Testing different buffer conditions (pH, salt concentration)

  • Evaluating temperature dependence (particularly important for a plant pathogen like Leifsonia xyli)

  • Screening various detergents and lipids for optimal activity

  • Comparing kinetic parameters with well-characterized LspA enzymes from other species

How can researchers effectively design and interpret site-directed mutagenesis experiments for Leifsonia xyli LspA?

Effective site-directed mutagenesis studies should follow this systematic approach:

  • Target residue selection:

    • Identify conserved residues by sequence alignment with well-characterized LspA enzymes

    • Focus on putative catalytic residues (likely aspartates in positions analogous to Asp118 and Asp136)

    • Include residues involved in substrate binding (e.g., residues in the β-cradle region)

    • Consider residues in the extracellular loop (EL) that may affect substrate specificity or inhibitor binding

  • Mutation design strategy:

    • Conservative mutations (e.g., Asp→Asn) to maintain structure while disrupting function

    • Non-conservative mutations to test hypotheses about specific functional roles

    • Alanine scanning of regions of interest

    • Introduce mutations that affect flexibility (e.g., Gly→Pro) in loops that may be functionally important

  • Functional assessment:

    • Compare enzyme kinetic parameters (Km, kcat) between wild-type and mutant proteins

    • Evaluate substrate specificity changes using multiple substrates

    • Assess inhibitor sensitivity changes

    • Test stability and folding to ensure mutations don't disrupt protein structure

  • Interpretation guidelines:

    • Consider both direct effects on catalysis and indirect effects on substrate binding

    • Use multiple mutations and multiple substrates to build a comprehensive model

    • Compare with equivalent mutations in well-characterized LspA enzymes

    • Interpret results in the context of available structural information

For example, in S. aureus LspA, mutating Gly54 to Pro in the extracellular loop fully inactivated the enzyme with lipoprotein substrate, highlighting the importance of loop flexibility . Similar strategic mutations in Leifsonia xyli LspA could reveal important structure-function relationships.

What approaches should be used to characterize the substrate specificity of Leifsonia xyli LspA compared to LspA from other bacterial species?

To comprehensively characterize substrate specificity:

  • Bioinformatic analysis:

    • Identify putative lipoproteins in Leifsonia xyli genome using prediction tools like LipoP

    • Compare lipobox sequences (the conserved sequence motif recognized by LspA) across predicted Leifsonia xyli lipoproteins

    • Perform comparative analysis with lipoprotein repertoires from other bacterial species

  • Synthetic substrate library screening:

    • Design FRET-based peptide substrates with systematic variations in the lipobox region

    • Measure kinetic parameters for each substrate variant

    • Compare substrate preferences with LspA from other species (e.g., S. aureus, P. aeruginosa)

  • Recombinant prolipoprotein processing:

    • Express and purify several Leifsonia xyli prolipoproteins

    • Compare processing efficiency of these native substrates

    • Test cross-processing by LspA from different species to assess specificity differences

  • Chimeric enzyme studies:

    • Create chimeric enzymes by swapping domains between Leifsonia xyli LspA and well-characterized LspA proteins

    • Identify regions responsible for substrate specificity differences

    • Focus on the β-cradle and extracellular loop regions that interact with substrates

  • Inhibitor sensitivity profiling:

    • Compare IC50 values for globomycin and myxovirescin between different LspA orthologs

    • Differences in inhibitor sensitivity may reflect differences in active site architecture relevant to substrate specificity

For example, S. aureus LspA showed different substrate affinity compared to P. aeruginosa LspA, with estimated apparent Km values of 47 μM versus 10 μM respectively, and much lower Vmax values (2.5 versus 107 nmol/(mg min)) . Similar comparative analyses with Leifsonia xyli LspA could reveal species-specific adaptations in enzyme function.

How can structural information about LspA inform the development of diagnostic tools for Leifsonia xyli infection in sugarcane?

Structural knowledge of LspA can contribute to diagnostic development through:

  • Antibody-based diagnostics:

    • Identifying unique, surface-exposed epitopes in Leifsonia xyli LspA for specific antibody development

    • Using structural information to design peptide antigens that mimic conformational epitopes

    • Developing immunoassays (ELISA, lateral flow) based on LspA-specific antibodies

  • Nucleic acid-based diagnostics:

    • Designing primers/probes targeting lspA gene regions with species-specific sequences

    • Developing quantitative LAMP-based diagnostics similar to those described for Leifsonia xyli detection in sugarcane

    • Creating multiplex PCR assays that include lspA alongside other diagnostic genes

  • Enzyme activity-based diagnostics:

    • Developing assays that detect LspA activity directly in plant samples

    • Using species-specific substrates or inhibitor profiles to distinguish Leifsonia xyli LspA from other bacterial enzymes

    • Creating biosensors based on LspA substrate processing

As shown by Chakraborty et al. (2024), LAMP-based diagnostics for Leifsonia xyli subsp. xyli correlate with sugarcane ratoon stunting disease rating . Incorporating LspA-specific detection into such systems could enhance specificity and provide functional information about the pathogen.

What insights can comparative studies of Leifsonia xyli LspA provide about bacterial evolution and host adaptation?

Comparative analysis of Leifsonia xyli LspA can reveal:

  • Evolutionary relationships:

    • Phylogenetic analyses to position Leifsonia xyli LspA among other bacterial LspA enzymes

    • Identification of conserved versus variable regions reflecting functional constraints

    • Assessment of selection pressures on different protein domains

  • Host adaptation mechanisms:

    • Comparison of substrate specificity between LspA from plant pathogens versus animal pathogens

    • Identification of unique features that may reflect adaptation to plant host environments

    • Analysis of the lipoprotein repertoire processed by LspA in different ecological niches

  • Antimicrobial resistance insights:

    • Comparison of inhibitor sensitivity profiles between species

    • Identification of natural variations that confer resistance to LspA inhibitors

    • Understanding the molecular basis of species-specific drug sensitivity

  • Functional specialization:

    • Analysis of kinetic parameters across species to identify functional adaptations

    • Correlation of enzyme properties with bacterial lifestyle (pathogen vs. commensal)

    • Investigation of extracellular loop variations that may affect substrate recognition

For example, the study of S. aureus LspA revealed distinctive features compared to P. aeruginosa LspA, including differences in catalytic efficiency and inhibitor sensitivity . Similar comparative analyses including Leifsonia xyli LspA could provide insights into how this enzyme has evolved in the context of a plant pathogen.

How can recombinant Leifsonia xyli LspA be used to validate potential antimicrobial targets in this plant pathogen?

Recombinant LspA can be used to validate antimicrobial strategies through:

  • Target validation experiments:

    • Enzyme inhibition assays to confirm that LspA is druggable

    • Correlation of in vitro inhibition with bacterial growth inhibition

    • Creation of conditional mutants to confirm essentiality under relevant conditions

  • High-throughput screening platforms:

    • Development of FRET-based assays suitable for screening compound libraries

    • Counter-screening against mammalian and plant enzymes to assess selectivity

    • Secondary assays to confirm mechanism of action for hit compounds

  • Structure-based drug design:

    • Using crystal structures (if available) or homology models to guide inhibitor optimization

    • Virtual screening to identify compounds that target the LspA active site

    • Fragment-based approaches to develop novel inhibitor scaffolds

  • Resistance mechanism studies:

    • In vitro selection of resistant mutants to identify potential resistance mechanisms

    • Site-directed mutagenesis to confirm the impact of specific mutations on inhibitor binding

    • Development of inhibitor combinations targeting multiple sites to reduce resistance potential

The research on globomycin and myxovirescin has revealed a common 19-atom motif that appears to be critical for LspA inhibition . This motif could serve as a starting point for developing inhibitors specific to Leifsonia xyli LspA, potentially leading to selective antimicrobials for controlling sugarcane ratoon stunting disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.