Recombinant Leifsonia xyli subsp. xyli Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CrcB2 is a homolog of the CrcB family, which is associated with stress response and membrane transport in bacteria. The recombinant version is produced for research purposes, with the following characteristics:

PropertyDetail
Uniprot IDQ6AHI4
SpeciesLeifsonia xyli subsp. xyli (strain CTCB07)
Expression RegionAmino acids 1–145 (full-length)
TagDetermined during production
StorageTris-based buffer with 50% glycerol; store at -20°C or -80°C
SequenceMSRRSSFPVHLHGRSmLLVFVGGALGTAARALLSAAAPTVAVISVITFVINVIGAFVLGWLLESLALRGPDEGRRRDVRLFAGTGVLGGFTTYSAFAVDTDGLIVASNVGGGILYAAATIAIGAAAYLAGIALGAAIGCRRGVSA

This protein is not commercially available but is utilized in experimental studies to investigate its structural and functional roles .

Genomic Context and Functional Implications

The crcB2 gene (Lxx00690) is part of the Lxx genome, which contains 2,044 intact protein-coding genes and 307 pseudogenes (13% of total genes) . Key genomic insights include:

  • GC Content: 67.7%, typical for Actinobacteria .

  • Pathogenicity Link: While crcB2 itself is not directly studied in pathogenicity, Lxx membrane proteins like Lxx18460 (anti-sigma factor) have been shown to disrupt host photosynthesis, hormone balance, and antioxidant enzyme activity .

  • Conservation: CrcB homologs are widespread in bacteria, often linked to chloride ion transport and stress adaptation .

Current Research Focus

  • Host-Pathogen Interaction: Studies on Lxx prioritize proteins involved in sugarcane colonization, such as cellulases and pectinases . While crcB2 is not explicitly analyzed, its homology to stress-response proteins suggests potential roles in bacterial survival within xylem vessels .

  • Transgenic Models: Functional analyses of Lxx proteins (e.g., Lxx18460) use transgenic tobacco to mimic pathogen effects, revealing growth inhibition and metabolic disruption . Similar methodologies could apply to crcB2.

Unresolved Questions

  • No peer-reviewed studies directly characterize crcB2’s biochemical role or its contribution to RSD.

  • The protein’s interaction partners, regulatory pathways, and stress-response mechanisms remain unstudied .

Comparative Genomic Insights

The Lxx genome is highly reduced, with 70.6% coding regions and extensive pseudogenization, indicating adaptation to a nutrient-rich host environment . Key comparisons:

FeatureLeifsonia xyli subsp. xyliClavibacter michiganensis
Genome Size2.58 Mbp3.3–3.5 Mbp
Pseudogenes13%<5%
Host SpecificitySugarcane xylemMultiple plants

This genomic austerity underscores Lxx’s reliance on host-derived nutrients, potentially shaping crcB2’s functional niche .

Future Directions

  • Functional Characterization: Heterologous expression in model systems (e.g., Nicotiana tabacum) to assess crcB2’s impact on host physiology .

  • Omics Integration: Transcriptomic or proteomic profiling of crcB2-expressing strains to identify downstream targets.

  • Structural Studies: Resolving the protein’s 3D structure to infer mechanistic roles .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
crcB2; Lxx00690; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Leifsonia xyli subsp. xyli (strain CTCB07)
Target Names
crcB2
Target Protein Sequence
MSRRSSFPVHLHGRSMLLVFVGGALGTAARALLSAAAPTVAVISVITFVINVIGAFVLGW LLESLALRGPDEGRRRDVRLFAGTGVLGGFTTYSAFAVDTDGLIVASNVGGGILYAAATI AIGAAAYLAGIALGAAIGCRRGVSA
Uniprot No.

Target Background

Function
Plays a crucial role in reducing fluoride concentration within cells, mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of CrcB homolog 2 in Leifsonia xyli subsp. xyli?

The CrcB homolog 2 gene should be examined within the context of the complete 2.6 Mb genome of Leifsonia xyli subsp. xyli, which contains approximately 2022 open reading frames and has a GC content of 68% . To investigate this gene's genomic neighborhood, researchers should perform comparative genomic analysis using the sequenced Brazilian L. xyli subsp. xyli isolate (CTCB07) as a reference. The gene might be part of an operon structure, similar to other membrane proteins identified in Lxx. Bioinformatic analysis of the flanking regions can provide insights into potential co-regulated genes that might functionally interact with the CrcB homolog 2 protein.

How can I isolate and clone the CrcB homolog 2 gene from Leifsonia xyli subsp. xyli?

The isolation and cloning process for CrcB homolog 2 can follow established protocols used for other Lxx genes. Begin by extracting total RNA from Lxx-infected sugarcane using Trizol Reagent, then prepare cDNA templates for RACE-PCR amplification . Design specific primers based on the CrcB homolog 2 sequence from the genome database. Follow with RT-PCR using a procedure similar to other Lxx genes: 10 minutes at 95°C for denaturation, followed by 40 cycles of 40 seconds at 94°C, 40 seconds at an appropriate annealing temperature, and 90 seconds at 72°C, with a final extension for 10 minutes at 72°C . Recover, purify, and clone the amplified target bands into a suitable vector (such as pMD18-T), transform into competent cells, and confirm positive clones through sequencing.

What expression systems are suitable for producing recombinant CrcB homolog 2 protein?

Based on successful expression of other Lxx proteins, two primary expression systems can be considered:

  • Prokaryotic expression system: The CrcB homolog 2 gene can be cloned into a prokaryotic expression vector like pET-30a and transformed into E. coli BL21(DE3)pLysS. Following IPTG induction, the recombinant protein can be isolated, purified, and analyzed by SDS-PAGE. This system is advantageous for quick production but may present challenges with proper folding of membrane proteins .

  • Plant-based expression system: For functional studies, consider Agrobacterium-mediated transformation into model plants such as tobacco. The full-length open reading frame (ORF) of CrcB homolog 2 can be cloned into a plant expression vector (like pBI121) under control of the CaMV35S promoter and NOS terminator . This approach allows for in vivo functional analysis in a heterologous system.

How can I assess the subcellular localization of CrcB homolog 2 in both bacterial and plant systems?

To determine subcellular localization, employ a multi-faceted approach:

  • Computational prediction: Utilize transmembrane structure prediction tools such as TMPRED Server and TMHMM2.0 to identify potential transmembrane domains in the CrcB homolog 2 protein sequence .

  • Fluorescent protein fusion: Generate C-terminal or N-terminal fusions with GFP or other fluorescent proteins to visualize localization in vivo. Consider the orientation of the fusion to avoid disrupting potential transmembrane domains.

  • Subcellular fractionation: Separate bacterial or plant cell components through differential centrifugation, followed by Western blot analysis using antibodies specific to the recombinant CrcB homolog 2 protein.

  • Immunolocalization: Generate specific antibodies against the purified recombinant protein and use them for immunogold labeling coupled with electron microscopy to precisely determine subcellular localization.

What strategies can overcome the challenges of working with Leifsonia xyli subsp. xyli for CrcB homolog 2 studies?

Leifsonia xyli subsp. xyli is notoriously difficult to culture in vitro, which complicates molecular studies. Several strategies can address this challenge:

  • Optimized growth conditions: Supplement media with filter-sterilized xylem extract from Lxx-infected sugarcane, which has been shown to enhance colonization and growth .

  • Heterologous expression systems: Use model organisms for functional studies, such as tobacco plants or bacterial systems like E. coli, while acknowledging the limitations of heterologous systems .

  • Stable transformation vectors: Utilize cosmid vectors harboring the RP4 broad host range origin of replication, such as derivatives of pLAFR3 or pLAFR5, which have proven to be highly stable in Lxx, unlike some other vectors that show instability .

  • Transposon mutagenesis approach: Consider using transposon mutagenesis to generate Lxx mutants with disrupted CrcB homolog 2 genes, followed by phenotypic analysis to determine function .

How can I evaluate the role of CrcB homolog 2 in pathogenicity and fluoride resistance?

To assess the functional role of CrcB homolog 2 in pathogenicity and potential fluoride resistance:

  • Knockout/knockdown studies: Create CrcB homolog 2 mutants using transposon mutagenesis or CRISPR-Cas systems adapted for Lxx. Evaluate colonization ability by inoculating sugarcane with mutant strains and quantifying bacterial populations using established immunoassay methods .

  • Fluoride sensitivity assays: Compare growth of wild-type and CrcB homolog 2 mutant strains in media containing various concentrations of sodium fluoride to assess potential roles in fluoride resistance.

  • Heterologous expression: Express CrcB homolog 2 in model bacterial systems lacking endogenous CrcB genes and test for complementation of fluoride sensitivity.

  • Transcriptome analysis: Perform RNA-seq to identify differentially expressed genes between wild-type and CrcB homolog 2 mutants, focusing on pathogenicity-related pathways.

How should I interpret transcriptomic data when analyzing CrcB homolog 2 function in pathogen-host interactions?

When analyzing transcriptomic data related to CrcB homolog 2 expression or knockout effects:

  • Pathway analysis: Focus on differentially expressed genes involved in key metabolic pathways such as signal transduction, secondary metabolism, and carbohydrate metabolism, which have been shown to be significantly affected by other Lxx membrane proteins .

  • Cross-validation: Validate transcriptomic findings using RT-qPCR for selected genes of interest.

  • Heterologous system considerations: When using model organisms like tobacco for functional studies, acknowledge that observed effects might differ from those in the native host. The table below illustrates potential differences in transcriptomic responses:

ParameterIn native host (sugarcane)In heterologous host (tobacco)Interpretation considerations
Hormone-related genesDirect pathogenicity relevanceMay indicate general stress responseCompare with known Lxx pathogenicity factors
Defense enzyme genesHost-specific resistance mechanismsGeneral plant defense mechanismsConsider evolutionary conservation of pathways
Photosynthesis genesDirect disease symptom relevanceMay indicate general health impactsConnect to known RSD symptoms
Membrane transportHost-specific interactionConserved cellular processesFocus on conserved mechanisms
  • Integration with phenotypic data: Correlate transcriptomic changes with observed phenotypic effects in both plants and bacterial cultures.

What bioinformatic approaches are most effective for predicting CrcB homolog 2 structure and function?

When performing bioinformatic analysis of CrcB homolog 2:

  • Comparative sequence analysis: Perform BLAST analysis against diverse bacterial species to identify conserved domains and potential functional motifs. Based on patterns observed with other Lxx proteins, expect relatively low sequence identity (30-42%) with homologs from other bacterial species .

  • Structural prediction: Use protein structure prediction tools such as AlphaFold to model the three-dimensional structure, with particular attention to transmembrane domains characteristic of CrcB proteins.

  • Conserved domain identification: Utilize NCBI CDD (Conserved Domain Databases) and SMART to identify functional domains that might provide insights into protein function .

  • Genomic context analysis: Examine the genomic neighborhood of CrcB homolog 2 for potential functionally related genes, which may form operons or functional clusters.

How can I optimize protein purification protocols for CrcB homolog 2 as a transmembrane protein?

Purifying transmembrane proteins like CrcB homolog 2 presents specific challenges:

  • Detergent selection: Test multiple detergents (DDM, LDAO, Triton X-100) for solubilization efficiency while maintaining protein structure and function.

  • Affinity tags placement: Consider both N-terminal and C-terminal tagging strategies, as transmembrane topology may affect tag accessibility. Based on approaches used for other Lxx membrane proteins, a 6xHis tag might be appropriate.

  • Native purification: For functional studies, consider purifying the protein in nanodiscs or amphipols to maintain the native membrane environment.

  • Stability optimization: Identify buffer conditions (pH, salt concentration, glycerol percentage) that enhance stability during purification using thermal shift assays.

  • Quality control: Verify protein integrity using circular dichroism spectroscopy to ensure proper folding of purified protein.

What are the most effective methods for analyzing protein-protein interactions involving CrcB homolog 2?

To investigate protein-protein interactions involving CrcB homolog 2:

  • Bacterial two-hybrid system: Adapt a bacterial two-hybrid system suitable for membrane proteins to screen for potential interaction partners.

  • Co-immunoprecipitation: Generate specific antibodies against CrcB homolog 2 for pull-down experiments followed by mass spectrometry to identify interaction partners.

  • Bimolecular Fluorescence Complementation (BiFC): For in planta studies, use BiFC to visualize potential interactions in vivo.

  • Yeast split-ubiquitin system: This system is specifically designed for membrane protein interaction studies and can be used to screen potential interaction partners.

  • Cross-linking mass spectrometry: Use chemical cross-linking combined with mass spectrometry to identify proximal proteins in the native membrane environment.

How does CrcB homolog 2 function potentially relate to other virulence factors in Leifsonia xyli subsp. xyli?

  • Comparative functional analysis: Compare phenotypes of CrcB homolog 2 mutants with mutants of known virulence factors such as the Lxx18460 anti-sigma K factor, which has been shown to affect plant growth, photosynthesis, and hormone levels .

  • Regulatory network analysis: Investigate whether CrcB homolog 2 is regulated by or regulates other virulence factors, particularly in response to environmental signals such as xylem composition.

  • Co-expression studies: Identify genes co-expressed with CrcB homolog 2 during infection using transcriptomic approaches to place it within the broader pathogenicity network.

  • Evolutionary analysis: Compare CrcB homolog conservation across different Leifsonia strains and related phytopathogens to understand its evolutionary importance in pathogenicity.

How can CrcB homolog 2 research contribute to developing strategies for controlling Ratoon Stunting Disease?

Research on CrcB homolog 2 can contribute to RSD control through several avenues:

  • Target-based antimicrobial development: If CrcB homolog 2 proves essential for Lxx survival or virulence, it could serve as a target for novel antimicrobial compounds specific to Lxx.

  • Genetic resistance strategies: Understanding the interaction between CrcB homolog 2 and host factors could inform breeding programs for sugarcane varieties with enhanced resistance.

  • Diagnostic development: CrcB homolog 2-specific antibodies or nucleic acid detection methods could be developed for improved RSD diagnostics.

  • Competitive inhibition approaches: If CrcB homolog 2 functions in fluoride resistance, fluoride-based treatments might be developed to specifically target Lxx while minimizing impacts on beneficial organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.