Recombinant Leishmania tarentolae Cytochrome c oxidase subunit 2

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leishmania tarentolae Cytochrome c Oxidase Subunit 2

Recombinant Leishmania tarentolae Cytochrome c oxidase subunit 2 is a protein derived from the protozoan parasite Leishmania tarentolae, which is used as a host for recombinant protein expression due to its ability to produce high-quality proteins with mammalian-like glycosylation patterns . This subunit is part of the cytochrome c oxidase complex (Complex IV), a crucial component of the mitochondrial electron transport chain responsible for generating ATP in cells .

Structure and Function

Cytochrome c oxidase is a multicomponent enzyme complex composed of several subunits, with more than 14 subunits identified in trypanosomatids like Leishmania . The recombinant subunit 2 protein from Leishmania tarentolae is specifically expressed using cell-free expression systems, allowing for precise control over protein production conditions .

CharacteristicsDescription
SourceLeishmania tarentolae
Protein TypeRecombinant protein
SubunitCytochrome c oxidase subunit 2
Expression MethodCell-free expression
SizeAvailable in various sizes, e.g., 50 μg

Biotechnological Applications

Leishmania tarentolae is recognized as a promising host for recombinant protein production due to its ability to perform complex post-translational modifications similar to those in mammalian cells . The recombinant cytochrome c oxidase subunit 2 can be used in research settings to study mitochondrial function, protein expression, and potentially as a component in vaccine development or therapeutic applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Leishmania tarentolae (Sauroleishmania tarentolae)
Target Protein Sequence
MAFILSFWMIFLLDSVIVLLSFVCFVCVWICALLFSTVLLVSKLNNIYCTWDFTASKFID VYWFTIGGMFSLGLLLRLCLLLYFGHLNFVSFDLCKVVGFQWYWVYFIFGETTIFSNLIL ESDYMIGDLRLLQCNHVLTLLSLVIYKLWLSAVDVIHSFAISSLGVKVDCIPGRCNEIVL FSSNNATVYGQCSELCGVLHGFMPIVICFI
Uniprot No.

Target Background

Function

Recombinant Leishmania tarentolae Cytochrome c oxidase subunit 2: A component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center (in subunit 2) and heme a (in subunit 1) to the active site (in subunit 1), a binuclear center (BNC) comprised of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is Cytochrome c oxidase subunit 2 encoded and expressed in L. tarentolae?

In L. tarentolae, COX2 is encoded in the kinetoplast mitochondrial genome . Unlike some other kinetoplastid mRNAs that undergo extensive RNA editing, evidence suggests that COX2 is translated from an unedited mRNA . This differs from other mitochondrially encoded proteins like cytochrome b and cytochrome oxidase subunit III (COIII), which display patterns of editing consistent with a progressive 3' to 5' editing process .

The detection of COX2 within the functional respiratory complex has been challenging, possibly due to aggregation upon dissociation of the complex in SDS or oligomerization . Researchers have successfully detected this protein using specific antibodies in association with the cytochrome c oxidase complex in BN/Tricine-SDS two-dimensional gels .

What are the key differences between mitochondrial respiratory complexes in Leishmania species versus mammalian systems?

Significant differences exist between Leishmania and mammalian respiratory systems:

FeatureLeishmania speciesMammalian systems
Complex IClassical NADH dehydrogenase (complex I) not found in its typical formStandard complex I present
Alternative NADH oxidationUtilize type II NADH dehydrogenase (NDH2)Primarily rely on complex I
RNA editingExtensive editing required for some mitochondrial genesNo RNA editing required
Drug susceptibilityCytochrome c oxidase is a potential target for MiltefosineDifferent drug targets
Nuclear-encoded componentsMost have no apparent homologue outside TrypanosomatidsMore conserved components

Notably, the Leishmania NDH2 is essential for parasite viability and can functionally substitute for complex I activity . The trypanosomatid cytochrome c oxidase complex includes unique components with no apparent homologues in other organisms .

What methods are used to isolate and characterize native Cytochrome c oxidase from L. tarentolae?

Isolation and characterization of native CcO from L. tarentolae typically involves:

  • Isolation of kinetoplast mitochondria: Differential centrifugation to separate kinetoplast mitochondria from other cellular components .

  • Detergent solubilization: Lysing mitochondria with dodecyl maltoside to solubilize membrane proteins while maintaining protein complex integrity .

  • Chromatographic purification: Two cycles of chromatography on DEAE-Sepharose. In the first step (under conditions optimized for cytochrome c reductase purification), the oxidase does not bind to the column. The flow-through fraction containing oxidase is then diluted to reduce NaCl concentration to 130 mM and re-applied to the column, followed by elution with a linear gradient of 130-500 mM NaCl .

  • Activity assays: Cytochrome c oxidase activity is determined using horse cytochrome c as substrate .

  • Gel electrophoresis: Blue Native gel electrophoresis combined with Tricine-SDS PAGE for two-dimensional resolution of the complex components .

  • Protein microsequencing: Proteins are electroblotted onto PVDF membranes, stained with Coomassie R-250, and subjected to N-terminal or internal sequence analysis .

What challenges exist in expressing and studying recombinant L. tarentolae COX2?

Several significant challenges complicate the study of recombinant L. tarentolae COX2:

  • Membrane protein expression: As a hydrophobic integral membrane protein, COX2 is difficult to express in soluble form and tends to aggregate during purification .

  • Complex assembly: COX2 functions as part of a multisubunit complex, making it challenging to study in isolation. Proper assembly requires correct incorporation of heme groups and other cofactors .

  • Mitochondrial targeting: When expressed recombinantly, ensuring proper targeting to the mitochondrial inner membrane is problematic .

  • Post-translational modifications: Any uncharacterized modifications essential for function may be absent in recombinant systems .

  • Functional assessment: Evaluating activity requires integration into a functional electron transport chain or development of specialized assays .

  • Oligomerization: Evidence suggests COX2 may form multiple bands during electrophoresis, indicating potential aggregation or oligomerization that complicates structural analysis .

How does the catalytic mechanism of CcO differ between intermediates in the enzyme cycle?

Recent high-resolution cryo-EM structures have revealed unexpected insights into the catalytic intermediates of cytochrome c oxidase:

StateConventional ViewRevised Model (Based on Recent Structures)Resolution
O-state (oxidized)Fe a₃³⁺-OH⁻, CuB²⁺-OH⁻May contain a peroxide dianionUp to 1.9 Å
E-stateReduced formIntermediate between O and R statesVariable
R-state (reduced)Fe a₃²⁺, CuB¹⁺, binds O₂Confirmed reduced form that binds O₂Variable
P-stateContains split dioxygen bondMay contain intact dioxygen moleculeVariable
F-stateFe a₃⁴⁺=O²⁻, CuB²⁺-OH⁻May contain superoxide anionVariable

These findings suggest that the enzyme's catalytic cycle may need to be reconceptualized, possibly being "turned by 180 degrees" from the conventional understanding . The thermodynamically constrained mechanistic models must now account for these structural findings to accurately describe electron transfer and proton pumping mechanisms .

What role does L. tarentolae cytochrome c oxidase play in potential drug targeting for leishmaniasis?

Recent studies suggest that Leishmania cytochrome c oxidase represents a potential target for the oral drug Miltefosine . This is significant because:

  • Essential function: As the terminal enzyme in the electron transport chain, inhibition of CcO directly impacts energy production necessary for parasite survival .

  • Structural uniqueness: Most nuclear-encoded components of CcO in trypanosomatids have no apparent homologues outside this group, potentially allowing for selective targeting .

  • Metabolic vulnerability: Disruption of respiratory function creates metabolic vulnerabilities that can be exploited therapeutically .

  • Cross-applicability: Findings may extend to other Leishmania species that cause human disease, as fundamental aspects of respiratory metabolism are conserved within the genus .

Research methodologies for exploring CcO as a drug target include:

  • Comparative structural analysis between human and parasite CcO

  • High-throughput screening against purified CcO complex

  • Assessment of growth inhibition in drug-treated parasites

  • Measurement of oxygen consumption and ATP production in treated parasites

How do genomic and proteomic approaches enhance our understanding of L. tarentolae COX2 in relation to mitochondrial function?

Ultradeep proteomic approaches have significantly advanced our understanding of mitochondrial proteins in Leishmania:

  • Proteome expansion: Recent deep peptide fractionation followed by complementary fragmentation approaches with higher-energy collisional dissociation (HCD) and electron transfer dissociation (ETD) has identified over 6,500 proteins in L. major, nearly doubling the experimentally known proteome .

  • Mitochondrial proteome characterization: This approach has revealed significant quantitative differences in mitochondrial-associated proteins between wild-type and mutant Leishmania strains .

  • Impact of genetic modifications: Studies of Δlpg2⁻ and Δfut1ˢ mutants have shown FUT1-dependent changes linked to marked alterations within mitochondrial-associated proteins, suggesting interconnected regulation between mitochondrial systems .

  • Post-translational modifications: Deep proteomic analyses can detect potential glycosylation or other modifications essential for CcO function .

Methodological approach for proteomic characterization:

  • Sample preparation with deep peptide fractionation

  • Complementary fragmentation approaches (HCD and ETD)

  • Protein identification and quantification

  • Statistical analysis (ANOVA testing with FDR of 0.05)

  • Data normalization by Z-scoring

  • Heat map construction and cluster analysis

What evidence exists for RNA editing of mitochondrial genes encoding cytochrome c oxidase components in L. tarentolae?

RNA editing patterns differ between mitochondrial genes in L. tarentolae:

  • COX2 (Cytochrome c oxidase subunit 2): Evidence suggests COX2 is translated from an unedited mRNA, making it unusual among kinetoplastid mitochondrial genes .

  • COX3 (Cytochrome c oxidase subunit III): Exhibits extensive RNA editing with both expected and unexpected patterns:

    • 177 out of 304 clones displayed strictly progressive 3' to 5' patterns of editing

    • 127 clones showed unexpected patterns where upstream editing preceded downstream editing

    • Some clones showed uridines inserted at sites not normally edited

    • Some displayed purine residue deletions

  • Cytochrome b: Shows more consistent editing patterns:

    • 102 out of 106 clones displayed patterns consistent with strictly progressive 3' to 5' editing

    • Follows the guide RNA model of RNA editing more consistently than COX3

The hypothesis for unexpected editing patterns suggests that some RNAs are produced by normal 3' to 5' editing but with incorrect guide RNA molecules . This complexity in RNA editing may contribute to the challenges in detecting and characterizing native mitochondrial proteins.

How can researchers effectively assess the functional integrity of recombinant L. tarentolae COX2?

To evaluate functional integrity of recombinant L. tarentolae COX2, researchers should:

  • Spectroscopic analysis:

    • Absorption spectroscopy to verify correct incorporation of heme groups

    • Measure characteristic peaks for reduced and oxidized forms

  • Oxygen consumption assays:

    • Clark-type electrode measurements to quantify O₂ reduction activity

    • Determine kinetic parameters including Km and Vmax values under varying conditions

  • Electron transfer assessment:

    • Measure cytochrome c oxidation rates

    • Analyze the effects of membrane potential (ΔΨ) and pH on enzyme activity

  • Proton pumping activity:

    • Use pH-sensitive dyes or electrodes to measure proton translocation

    • Calculate H⁺/e⁻ ratios to assess coupling efficiency

  • Inhibitor sensitivity:

    • Test response to known CcO inhibitors (e.g., cyanide, azide)

    • Compare IC₅₀ values to native enzyme

  • Structural verification:

    • Circular dichroism to assess secondary structure

    • Proper assembly with other subunits using Blue Native PAGE

The apparent Km of O₂ and Vmax are not fixed values but functions of the cytochrome c reduced fraction (fred), membrane potential (ΔΨ), and pH, making comprehensive characterization under varying conditions essential .

What potential exists for L. tarentolae as a model system for studying eukaryotic cytochrome c oxidase?

L. tarentolae offers several advantages as a model system:

  • Biosafety: Most strains are non-pathogenic to humans and can be handled as laboratory culture without high biosafety requirements (unlike human-pathogenic Leishmania species) .

  • Cultivation ease: Relatively easy and cost-effective to cultivate compared to other eukaryotic models .

  • Unusual mitochondrial biology: The kinetoplast mitochondrial genome network (kDNA) and RNA editing processes provide unique insights into mitochondrial gene expression not available in conventional models .

  • Expression system capabilities: L. tarentolae can express functional mammalian proteins with proper post-translational modifications, offering potential for heterologous expression of respiratory components .

  • Evolutionary insights: Studying COX2 in this organism can provide evolutionary perspectives on the development of respiratory systems in eukaryotes .

Limitations include:

  • Some strains (e.g., LEM-125) may be transiently infectious to humans

  • The kDNA changes significantly during continuous culture, potentially resulting in loss of some proteins not required in cell culture

  • Differences in respiratory chain organization compared to mammalian systems

How can structural biology approaches best be applied to study L. tarentolae cytochrome c oxidase?

Modern structural biology approaches offer powerful tools for studying L. tarentolae CcO:

  • Cryo-electron microscopy (cryo-EM):

    • Can achieve resolutions up to 1.9 Å for cytochrome c oxidase complexes

    • Enables visualization of catalytic intermediates without crystallization

    • Allows identification of bound substrates, water molecules, and conformational changes

  • X-ray crystallography:

    • Complements cryo-EM for high-resolution structural information

    • Time-resolved X-ray studies can capture structural changes during catalysis

    • X-ray free-electron laser (XFEL) enables studies of photolysis of CO-bound fully reduced CcO

  • Mass spectrometry:

    • Identifies subunit composition and post-translational modifications

    • Characterizes protein-protein interactions within the complex

    • Detects subtle structural differences between wild-type and mutant proteins

  • Spectroscopic methods:

    • Resonance Raman spectroscopy for heme environment characterization

    • EPR spectroscopy to examine paramagnetic centers

    • FTIR spectroscopy to study redox-coupled structural changes

  • Computational approaches:

    • Molecular dynamics simulations to study conformational changes

    • Quantum mechanical calculations for understanding electron transfer mechanisms

    • Simulation analysis for transitions between intermediate states (e.g., Pm→Pr→F transition)

Integration of these complementary approaches is essential for comprehensive structural and functional characterization of this complex enzyme system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.