Recombinant Leishmania tarentolae NADH-ubiquinone oxidoreductase chain 5 (ND5)

Shipped with Ice Packs
In Stock

Description

Essentiality in Parasite Survival

  • Genetic disruption of NDH2 (a related dehydrogenase) is lethal in Leishmania, even when complex I is functional .

  • ND5’s role in L. tarentolae remains unclear, but recombinant forms are used to study mitochondrial adaptations in non-pathogenic vs. pathogenic species .

Vaccine Antigen

  • Recombinant ND5 is marketed as a vaccine development tool due to its potential to stimulate immune responses against leishmaniasis .

  • L. tarentolae’s non-pathogenic nature and genetic similarity to pathogenic Leishmania species make it a safe platform for antigen production .

Mitochondrial Studies

  • Used to investigate electron transport chain anomalies in Leishmania, particularly the absence of complex I activity in L. tarentolae .

  • Comparative studies with pathogenic species (e.g., L. major) highlight evolutionary divergences in mitochondrial metabolism .

Production and Optimization

  • Expression Systems: L. tarentolae is engineered to secrete recombinant proteins via signal peptides (e.g., L. mexicana acid phosphatase signal peptide) .

  • Challenges: Proteolytic degradation in culture supernatants necessitates fusion with stabilizing tags (e.g., GST or fluorescent proteins) .

  • Yield Improvements: Strategies include codon optimization, secretory pathway engineering, and vesicle-associated delivery .

Future Directions

  • Functional Studies: Resolving ND5’s role in L. tarentolae could clarify mitochondrial evolution in trypanosomatids .

  • Therapeutic Potential: Exploring ND5 as a drug target or vaccine component requires further validation in animal models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND5; NADH-ubiquinone oxidoreductase chain 5; NADH dehydrogenase subunit 5; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Leishmania tarentolae (Sauroleishmania tarentolae)
Target Names
ND5
Target Protein Sequence
SFYLYYASFFDIALFTVFIIDIIKFYILSGVIFYFFNIDCIMFFWRVFLFITMGFLFFIF TTWYFICFYMYICMFIWNLVIYFRYNLKYCLFFCMLFIIYI
Uniprot No.

Target Background

Function
The NADH-ubiquinone oxidoreductase chain 5 (ND5) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be a part of the minimal assembly required for catalytic activity. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 5 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of NADH-ubiquinone oxidoreductase chain 5 (ND5) in Leishmania tarentolae?

NADH-ubiquinone oxidoreductase chain 5 (ND5) in Leishmania tarentolae is encoded by the mitochondrial genome. Unlike nuclear genes, ND5 is part of the kinetoplast DNA (kDNA) network, which consists of maxicircles and minicircles. The ND5 gene is located on the maxicircle component, which resembles conventional mitochondrial DNA. The gene spans approximately 1.8 kb and requires RNA editing for proper expression, a characteristic feature of trypanosomatid mitochondrial genes. This post-transcriptional modification involves the insertion or deletion of uridine residues guided by small RNAs encoded by the minicircles, resulting in translatable mRNAs.

What expression systems are most effective for recombinant production of Leishmania tarentolae ND5?

For recombinant expression of L. tarentolae ND5, several systems have demonstrated efficacy, each with distinct advantages:

  • Homologous expression in L. tarentolae: The LEXSY (Leishmania Expression System) permits expression within the organism itself, ensuring proper post-translational modifications. For mitochondrial proteins like ND5, this system can be adapted by using specialized vectors targeting the organelle.

  • Heterologous expression in E. coli: When using bacterial systems, codon optimization is essential as L. tarentolae has different codon usage patterns. For ND5 expression, vectors containing T7 promoters with N-terminal fusion tags (such as 6xHis) facilitate purification.

  • Mammalian cell expression: For functional studies requiring complex folding, mammalian systems like HEK293 cells can be employed using specialized vectors.

The selection methodology should be guided by experimental goals. For biochemical characterization, bacterial systems yield higher protein amounts, while for functional studies, the homologous LEXSY system better preserves native protein conformation and activity.

How does recombinant ND5 differ structurally and functionally from native ND5 in Leishmania tarentolae?

Recombinant ND5 proteins may exhibit several structural and functional differences from their native counterparts:

CharacteristicNative ND5Recombinant ND5
Post-translational modificationsComplete set of Leishmania-specific modificationsMay lack certain modifications depending on expression system
Membrane integrationProperly integrated into mitochondrial inner membraneMay require refolding when expressed in non-membrane environments
Complex formationForms part of respiratory Complex IOften isolated without partner proteins
RNA editingUndergoes complete RNA editingTypically expressed from already-edited cDNA
ActivityFull enzymatic activityVariable activity depending on expression system and purification

These differences emphasize the importance of choosing appropriate expression systems and validation methods when working with recombinant ND5. For accurate structural studies, researchers often employ homologous expression systems like the one described for L. tarentolae expressing other proteins, where the integration of foreign genes into the genome has been well-documented and can be confirmed through diagnostic PCR, RT-PCR, and Western blot analyses .

What are the optimal PCR conditions for amplifying the Leishmania tarentolae ND5 gene for recombinant expression?

For amplifying L. tarentolae ND5 gene with high fidelity for recombinant expression, the following optimized PCR protocol is recommended:

  • Template preparation: Extract kinetoplast DNA using phenol-chloroform methods or commercial kits specific for mitochondrial DNA isolation.

  • Primer design considerations:

    • Forward primer should include appropriate restriction sites for downstream cloning

    • Consider adding Kozak sequence or ribosome binding site depending on expression system

    • For ND5, include 15-20 nucleotides of complementary sequence to the 5' region

    • Reverse primer should contain compatible restriction site and stop codon management

  • PCR reaction composition:

    ComponentVolume (μL)Final Concentration
    High-fidelity DNA polymerase buffer (5X)101X
    dNTP mix (10 mM each)1200 μM each
    Forward primer (10 μM)2.50.5 μM
    Reverse primer (10 μM)2.50.5 μM
    DMSO2.55%
    Template DNA1-510-50 ng
    High-fidelity DNA polymerase0.51-1.5 U
    Nuclease-free waterto 50-
  • Thermal cycling parameters:

    • Initial denaturation: 98°C for 2 minutes

    • 30-35 cycles of:

      • Denaturation: 98°C for 20 seconds

      • Annealing: 60-65°C for 30 seconds (optimize based on primer Tm)

      • Extension: 72°C for 2 minutes (approximately 30 seconds/kb)

    • Final extension: 72°C for 10 minutes

    • Hold at 4°C

  • PCR product verification:

    • Analyze by agarose gel electrophoresis (0.8%)

    • Expected size for ND5: approximately 1.8 kb

    • Purify using gel extraction or PCR cleanup kits

This protocol minimizes mutation introduction while ensuring high yield of the target gene, similar to the amplification strategies used for other Leishmania genes as demonstrated in previous studies .

How can researchers optimize the purification of recombinant ND5 protein while maintaining its structural integrity?

Purification of recombinant ND5 protein presents unique challenges due to its hydrophobic nature and complex structure. The following methodological approach preserves structural integrity:

  • Solubilization strategy:

    • For bacterial expression systems, include 0.5-1% mild detergents (n-dodecyl-β-D-maltoside or digitonin) during lysis

    • Use buffers containing 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, and protease inhibitors

    • Perform extraction at 4°C with gentle agitation for 2-3 hours

  • Multi-step purification protocol:
    a. Affinity chromatography:

    • For His-tagged ND5, use Ni-NTA resin with imidazole gradient (20-250 mM)

    • Include 0.05% detergent in all buffers to prevent protein aggregation

    b. Size-exclusion chromatography:

    • Separate monomeric protein from aggregates using Superdex 200 column

    • Use buffer containing 20 mM HEPES (pH 7.2), 150 mM NaCl, 5% glycerol, and 0.02% detergent

    c. Ion-exchange chromatography (optional):

    • Further purify using MonoQ column at pH 8.0

    • Apply salt gradient (50-500 mM NaCl)

  • Quality assessment methods:

    • SDS-PAGE analysis (expect band at ~67 kDa)

    • Western blot verification using anti-His or specific anti-ND5 antibodies

    • Circular dichroism to confirm secondary structure

    • Activity assays measuring NADH:ubiquinone oxidoreductase activity

  • Storage conditions:

    • Store at -80°C in buffer containing 10% glycerol

    • Avoid freeze-thaw cycles

    • For long-term storage, aliquot in small volumes

This purification strategy balances yield with structural preservation, ensuring that the recombinant ND5 retains its native conformation as much as possible. Similar approaches have been used successfully for membrane-associated proteins in Leishmania, as demonstrated by the Western blot analysis techniques described for other recombinant Leishmania proteins .

What advanced analytical techniques are most informative for characterizing the structure-function relationship of recombinant Leishmania tarentolae ND5?

To comprehensively characterize the structure-function relationship of recombinant L. tarentolae ND5, the following advanced analytical approaches should be employed:

  • Structural analysis techniques:

    • Cryo-electron microscopy (Cryo-EM): Particularly valuable for membrane proteins like ND5, allowing visualization at near-atomic resolution without crystallization

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps protein dynamics and identifies conformational changes upon substrate binding

    • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution

    • NMR spectroscopy: For analyzing specific domains or protein-ligand interactions

  • Functional characterization methods:

    • Enzyme kinetics using purified ND5 reconstituted in liposomes:

      ParameterTypical Values for ND5Measurement Method
      K𝑚 for NADH10-30 μMSpectrophotometric (340 nm)
      K𝑚 for ubiquinone5-15 μMHPLC or electrochemical detection
      V𝑚𝑎𝑥0.5-2 μmol/min/mgInitial velocity measurements
      Inhibitor sensitivityIC₅₀ for rotenone: 0.1-1 μMDose-response curves
    • Membrane potential measurements using voltage-sensitive dyes

    • Proton pumping assays with pH-sensitive fluorescent probes

    • Reactive oxygen species (ROS) production analysis

  • Protein-protein interaction studies:

    • Blue native PAGE to analyze complex formation

    • Chemical cross-linking coupled with mass spectrometry

    • Surface plasmon resonance for interaction kinetics

    • Co-immunoprecipitation to identify binding partners

  • Computational approaches:

    • Molecular dynamics simulations to model conformational changes

    • Homology modeling based on bacterial or mammalian complex I structures

    • In silico docking studies for inhibitor design

By integrating these multiple analytical approaches, researchers can build a comprehensive understanding of how ND5's structure relates to its function in the mitochondrial electron transport chain. These advanced techniques have proven valuable in characterizing other complex membrane proteins and could be adapted for ND5 analysis using methodologies similar to those employed in previous Leishmania protein characterization studies .

What statistical approaches are most appropriate for analyzing enzyme kinetics data from recombinant ND5 assays?

When analyzing enzyme kinetics data from recombinant ND5 assays, researchers should employ specific statistical approaches to ensure accurate interpretation:

  • Primary kinetic data processing:

    • Apply non-linear regression rather than linear transformations (e.g., Lineweaver-Burk) as the primary analysis method

    • Use enzyme kinetics software packages (GraphPad Prism, DynaFit, or R packages) that directly fit to the Michaelis-Menten equation:
      v = (Vmax × [S]) / (Km + [S])

    • For complex I activity, account for potential substrate inhibition effects at high ubiquinone concentrations

  • Statistical model selection and validation:

    • Compare different kinetic models (simple Michaelis-Menten vs. allosteric models) using Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC)

    • Verify homoscedasticity assumptions in residual plots; if violated, apply weighted regression

    • Calculate 95% confidence intervals for all kinetic parameters

  • Replicate management and outlier detection:

    • Perform minimum of 3-5 independent experiments with technical triplicates

    • Use Dixon's Q test or Grubbs' test for objective outlier identification

    • Avoid removing data points without statistical justification

  • Advanced kinetic analysis for ND5:

    • For inhibitor studies, apply global fitting across multiple datasets

    • When comparing ND5 variants, use extra sum-of-squares F-test to determine if differences in parameters are statistically significant

    • For temperature dependence studies, analyze using Arrhenius plots with appropriate error propagation

  • Reporting requirements:

    ParameterRequired StatisticsVisualization
    K𝑚 valuesMean ± SEM, 95% CIForest plots
    V𝑚𝑎𝑥Mean ± SEM, 95% CIBar graphs with error bars
    k𝑐𝑎𝑡/K𝑚Calculate propagated errorComparative bar charts
    IC₅₀ valuesInclude Hill slope and 95% CISemi-log dose-response curves

How should researchers interpret contradictory results between in vitro and in vivo studies of recombinant Leishmania tarentolae ND5?

When faced with contradictory results between in vitro and in vivo studies of recombinant L. tarentolae ND5, researchers should employ a systematic analytical framework:

  • Systematic analysis of contradictions:

    a. Nature of discrepancies: Categorize contradictions as:

    • Activity discrepancies (e.g., inhibitor sensitivity differences)

    • Structural discrepancies (e.g., conformation or complex formation)

    • Localization discrepancies (e.g., mitochondrial incorporation)

    • Phenotypic discrepancies (e.g., effects on parasite viability)

    b. Methodological reconciliation approach:

    In Vitro ObservationIn Vivo ObservationPotential Reconciliation Approach
    High enzyme activityLow apparent activityExamine regulatory factors present in vivo
    Sensitivity to inhibitorResistance in vivoInvestigate drug metabolism or efflux mechanisms
    Simple complex formationIntegration into supercomplexesUse gentler extraction methods to preserve interactions
    Clear mitochondrial targetingDiffuse localizationEvaluate protein processing and folding in vivo
  • Biological factors explaining contradictions:

    • Post-translational modifications: In vivo phosphorylation, acetylation, or other modifications may alter activity

    • Protein-protein interactions: Partners present in vivo may modulate function

    • Substrate availability: Differences in local concentrations of NADH or ubiquinone

    • Membrane composition effects: Lipid environment impacts membrane protein function

    • Regulatory mechanisms: Allosteric regulations present only in the cellular context

  • Resolution strategies:

    a. Bridge methodologies:

    • Use permeabilized cells to maintain cellular architecture with controlled substrate access

    • Isolate mitochondria for intermediate complexity studies

    • Reconstitute purified protein in liposomes of varying complexity

    b. Orthogonal validation approaches:

    • Employ CRISPR/Cas9 to introduce tagged ND5 at the endogenous locus

    • Use proximity labeling to identify in vivo interaction partners

    • Apply metabolic flux analysis to assess functional impacts

  • Interpretation framework:

    • Consider evolutionary context: Compare with orthologous proteins from related species

    • Weigh physiological relevance: Prioritize conditions that most closely resemble parasite environment

    • Apply Occam's razor: The simplest explanation reconciling observations should be favored

This framework provides researchers with a structured approach to resolving contradictions between in vitro and in vivo studies of recombinant ND5, ultimately leading to more comprehensive understanding of this protein's biology. Similar approaches to reconciling experimental differences have been valuable in interpreting immune response data from Leishmania infection studies .

What are the most reliable biomarkers for assessing the functional incorporation of recombinant ND5 into mitochondrial Complex I?

To reliably assess the functional incorporation of recombinant ND5 into mitochondrial Complex I, researchers should employ multiple complementary biomarkers:

  • Direct biochemical indicators:

    • Complex I enzyme activity: NADH:ubiquinone oxidoreductase activity measured spectrophotometrically at 340 nm

    • Sensitivity to specific inhibitors: Response to rotenone, piericidin A, and other Complex I inhibitors

    • Proton pumping efficiency: H⁺/e⁻ ratio measurements using pH-sensitive dyes

    • Supercomplex formation: Blue native PAGE combined with in-gel activity assays

  • Structural incorporation markers:

    • Co-immunoprecipitation with other Complex I subunits

    • Crosslinking mass spectrometry to map protein-protein interactions

    • Protease protection assays: Incorporated ND5 shows different digestion patterns

    • Density gradient fractionation: Co-migration with intact Complex I

  • Functional cellular indicators:

    BiomarkerMethodologyExpected Result with Functional ND5Detection of Dysfunction
    Mitochondrial membrane potentialJC-1 or TMRM fluorescenceMaintenance of potentialDecreased potential
    ROS productionMitoSOX Red fluorescenceControlled ROS levelsElevated ROS
    ATP synthesisLuciferase-based assaysNormal ATP levelsDecreased ATP
    NADH/NAD⁺ ratioNAD(P)H autofluorescenceBalanced ratioElevated NADH
    Oxygen consumptionClark electrode or Seahorse analyzerNormal respiratory control ratioDecreased oxygen consumption
  • Genetic complementation assays:

    • Rescue of ND5-deficient cells with recombinant protein

    • Growth rate restoration

    • Resistance to oxidative stress

    • Maintenance of mitochondrial network morphology

  • Temporal dynamics assessment:

    • Pulse-chase analysis of incorporation kinetics

    • Turnover rate measurements using inducible expression systems

    • Assembly intermediate tracking using time-course proteomics

For comprehensive evaluation, at least one biomarker from each category should be assessed. The combination of these multiple lines of evidence provides robust confirmation of functional ND5 incorporation into Complex I. Similar multi-parameter approaches have been used to evaluate the expression and function of recombinant proteins in Leishmania systems, as evidenced by the comprehensive analysis methods described in previous research .

What are the most common pitfalls in expressing recombinant Leishmania tarentolae ND5 and how can they be addressed?

Researchers frequently encounter several critical challenges when expressing recombinant L. tarentolae ND5. Here are the most common pitfalls and their systematic solutions:

  • Low expression levels:

    • Pitfall: ND5's hydrophobic nature and unusual codon usage often result in poor expression

    • Solutions:

      • Optimize codon usage for the expression system (using Codon Adaptation Index >0.8)

      • Employ stronger inducible promoters (T7 or pLEXSY)

      • Use fusion partners (MBP, SUMO, or Thioredoxin) to enhance solubility

      • Reduce expression temperature (16-18°C for E. coli, 22-24°C for LEXSY)

      • Supplement media with rare tRNAs when using heterologous systems

  • Protein misfolding and aggregation:

    • Pitfall: As a membrane protein, ND5 tends to aggregate without proper membrane integration

    • Solutions:

      • Express in membrane fraction using signal sequences

      • Include mild detergents (0.1-0.5% n-dodecyl-β-D-maltoside) during extraction

      • Co-express with molecular chaperones (GroEL/GroES in bacteria, HSP70 in eukaryotes)

      • Use cell-free expression systems with supplied lipids or nanodiscs

      • Apply directed evolution to select for more soluble variants

  • Proteolytic degradation:

    • Pitfall: Misfolded ND5 often becomes target for proteolytic machinery

    • Solutions:

      • Include protease inhibitor cocktails during all purification steps

      • Use protease-deficient host strains

      • Identify and modify protease recognition sites without affecting function

      • Optimize extraction buffer composition (pH 7.5-8.0, 300-500 mM NaCl)

      • Perform all procedures at 4°C with minimal handling time

  • Lack of post-translational modifications:

    • Pitfall: Bacterial systems cannot perform Leishmania-specific modifications

    • Solutions:

      • Use homologous expression in L. tarentolae using the LEXSY system

      • Consider yeast or insect cell expression for closer approximation

      • Map essential modifications and engineer mimicking mutations

  • Poor incorporation into Complex I:

    • Pitfall: Recombinant ND5 may fail to integrate into the native complex

    • Solutions:

      • Co-express with adjacent subunits to facilitate assembly

      • Introduce tagged versions at the endogenous locus

      • Develop reconstitution protocols with isolated Complex I components

      • Use conditional knockdown of native ND5 to create assembly intermediates

These solutions have been derived from successful approaches with other challenging membrane proteins and can be adapted specifically for L. tarentolae ND5 expression. Implementing PCR validation strategies and protein expression confirmation methods similar to those used for other recombinant Leishmania proteins would help verify successful expression .

How can researchers troubleshoot unexpected enzyme kinetics when working with recombinant ND5?

When researchers encounter unexpected enzyme kinetics with recombinant ND5, a systematic troubleshooting approach is essential:

  • Validation of enzyme preparation quality:

    • Assess protein homogeneity by size-exclusion chromatography

    • Verify intact protein by mass spectrometry (check for truncations or modifications)

    • Confirm proper folding using circular dichroism or fluorescence spectroscopy

    • Examine lipid content using thin-layer chromatography if purified from membrane fractions

  • Systematic kinetic anomaly analysis:

    Kinetic AnomalyPotential CausesExperimental Investigation
    Sigmoidal kinetics instead of hyperbolicAllosteric regulationVary buffer conditions (ions, pH); test for allosteric effectors
    Unexpected substrate inhibitionNon-productive bindingPerform detailed substrate titrations; model with modified equations
    Biphasic Lineweaver-Burk plotsMultiple catalytic sites or isoformsSize-exclusion chromatography; native PAGE; subunit composition analysis
    Time-dependent activity lossOxidative damage; cofactor lossInclude reducing agents; supplement with potential cofactors
    Temperature dependence anomaliesConformational changes; membrane fluidity effectsArrhenius plots at multiple temperatures; lipid environment modifications
  • Buffer optimization strategy:

    • Systematically vary:

      • pH (range 6.5-8.5 in 0.5 unit increments)

      • Ionic strength (50-500 mM)

      • Divalent cations (0-10 mM Mg²⁺, Mn²⁺, Ca²⁺)

      • Detergent type and concentration

    • Test additives including glycerol (5-20%), reducing agents (DTT, β-mercaptoethanol)

    • Evaluate effects of cardiolipin and other mitochondrial lipids

  • Substrate and cofactor considerations:

    • Verify substrate purity by HPLC

    • For ubiquinone, test different chain length analogs (Q1, Q2, Q10)

    • Investigate potential need for Fe-S cluster reconstitution

    • Consider flavin requirement (FMN) and NAD⁺/NADH ratio effects

  • Advanced technical approaches:

    • Develop selective activity assays for ND5 subunit within Complex I

    • Use surface plasmon resonance to measure direct binding parameters

    • Apply hydrogen-deuterium exchange mass spectrometry to identify conformational factors

    • Consider single-molecule enzymology approaches for heterogeneity analysis

By methodically addressing these potential issues, researchers can identify the underlying causes of unexpected enzyme kinetics and develop appropriate experimental conditions for reliable characterization of recombinant ND5. Similar methodical approaches to optimizing experimental conditions have been crucial in previous Leishmania research for obtaining reliable cytokine profiles and enzyme activity measurements .

What strategies can overcome poor yields when purifying recombinant Leishmania tarentolae ND5?

Poor yields during recombinant L. tarentolae ND5 purification represent a significant challenge. The following comprehensive strategies can substantially improve recovery:

  • Optimized expression conditions:

    • Fine-tune induction parameters:

      • For bacterial systems: reduce IPTG concentration (0.05-0.1 mM) and expression temperature (16°C)

      • For LEXSY: optimize tetracycline concentration and harvest time (late log phase)

    • Scale up culture volume while maintaining optimal cell density

    • Supplement media with membrane protein expression enhancers:

      • δ-aminolevulinic acid (0.5 mM)

      • Specific lipids (0.1% phosphatidylethanolamine)

      • Osmolytes (betaine, 1-2 mM)

  • Enhanced extraction efficiency:

    • Sequential extraction protocol:

      • Initial gentle extraction with low detergent (0.5% n-dodecyl-β-D-maltoside)

      • Secondary extraction with increased detergent (1-2%)

      • Final extraction with stronger detergents (1% Triton X-100) for maximum recovery

    • Optimize physical disruption methods:

      • For bacteria: combination of lysozyme treatment and sonication

      • For Leishmania: nitrogen cavitation or electroporation

    • Use of specialized extraction buffers:

      Buffer ComponentConcentration RangeFunction
      Glycerol10-20%Stabilization
      KCl or NaCl250-500 mMReduce ionic interactions
      EDTA1-2 mMPrevent metal-catalyzed oxidation
      Detergent mixtureVariesSynergistic solubilization
      Specific lipids0.1-0.2 mg/mlMaintain native environment
  • Advanced purification strategies:

    • Implement tandem affinity purification (e.g., His-MBP or His-FLAG tags)

    • Consider on-column refolding protocols for inclusion body recovery

    • Use specialized chromatography media designed for membrane proteins

    • Employ high-resolution techniques for final polishing:

      • Hydroxyapatite chromatography

      • Mixed-mode chromatography

    • Consider detergent exchange during purification to optimize stability

  • Stability enhancement during purification:

    • Include chemical chaperones (glycerol, sucrose, arginine)

    • Add specific lipids (cardiolipin) to maintain native environment

    • Use antioxidants to prevent oxidative damage (5 mM DTT, 1 mM sodium ascorbate)

    • Maintain strict temperature control (4°C) throughout all procedures

    • Consider stabilizing nanodiscs or amphipols for final preparation

  • Yield assessment and quality control:

    • Implement regular monitoring of protein throughout purification

    • Establish minimum activity thresholds for each step

    • Develop high-sensitivity detection methods for trace amounts

    • Consider functional over absolute purity for specific applications

By implementing these strategies, researchers can achieve significant improvements in ND5 purification yields, often increasing recovery by 3-5 fold compared to standard protocols. Similar purification optimization approaches have been successfully applied to other challenging Leishmania proteins, as evidenced by the Western blot analysis techniques used to confirm protein expression in previous studies .

How can recombinant Leishmania tarentolae ND5 be used to develop novel anti-leishmanial drug screening platforms?

Recombinant L. tarentolae ND5 offers unique opportunities for developing sophisticated anti-leishmanial drug screening platforms that target mitochondrial function. The following methodological framework outlines how to establish such platforms:

  • Target-based screening systems:

    • Purified protein assay development:

      • Recombinant ND5 in reconstituted proteoliposomes for high-throughput screening

      • Enzymatic activity measured via NADH oxidation (absorbance at 340 nm)

      • Coupling with artificial electron acceptors for colorimetric detection

      • Membrane potential-sensitive fluorescent probes for functional assessment

    • Structure-based screening approaches:

      • In silico docking against ND5 homology models

      • Fragment-based screening using thermal shift assays

      • NMR-based fragment screening for weak binders

      • Surface plasmon resonance for binding kinetics

  • Cell-based screening platforms:

    • Engineered L. tarentolae strains:

      • Strains expressing tagged ND5 for immunodetection

      • Reporter systems coupled to mitochondrial function

      • ND5 conditional knockdown strains for target validation

      • CRISPR interference systems targeting ND5 expression

    • Phenotypic screening readouts:

      ReadoutMethodologyDetection ThresholdThroughput Capacity
      Mitochondrial membrane potentialJC-1 or TMRM fluorescence15-20% change384-well format
      ATP levelsLuciferase-based assays10% reduction1536-well format
      Growth inhibitionAlamar Blue or MTTIC₅₀ determinationHigh throughput
      ROS productionH₂DCFDA or MitoSOX2-fold increaseMedium throughput
      Mitochondrial morphologyHigh-content imagingQualitative changesMedium throughput
  • Counter-screening strategy:

    • Mammalian cell mitochondrial toxicity assessment

    • Yeast-based systems expressing mammalian Complex I

    • Isolated mammalian mitochondria functional assays

    • Cardiotoxicity evaluation in cardiomyocyte models

  • Target validation approaches:

    • Resistant mutant generation and whole-genome sequencing

    • Overexpression of ND5 to verify target engagement

    • CRISPR/Cas9-mediated introduction of point mutations

    • Metabolomic profiling to confirm mechanism of action

  • Integration with drug development pipeline:

    • Structure-activity relationship studies based on ND5 inhibition

    • Medicinal chemistry optimization of lead compounds

    • Pharmacokinetic and pharmacodynamic modeling

    • In vivo efficacy studies in leishmaniasis animal models

This comprehensive platform would enable the identification of specific inhibitors of Leishmania ND5 with potential therapeutic applications while minimizing off-target effects on host mitochondria. Similar methodological approaches for developing screening platforms have been applied in previous Leishmania research focused on vaccine development .

What insights can comparative studies of recombinant ND5 from different Leishmania species provide for evolution and adaptation research?

Comparative studies of recombinant ND5 from different Leishmania species offer valuable insights into evolutionary adaptations and species-specific functional characteristics:

  • Evolutionary analysis framework:

    • Sequence-structure-function relationships:

      • Cross-species sequence analysis revealing conserved functional domains

      • Identification of positively selected amino acid residues

      • Correlation of sequence variations with environmental adaptations

      • Reconstruction of ancestral sequences to track evolutionary trajectory

    • Structural divergence assessment:

      • Homology modeling of ND5 from different species

      • Molecular dynamics simulations to identify species-specific conformational preferences

      • Structural analysis of proton-pumping channels and ubiquinone binding sites

      • Assessment of interface regions with other Complex I subunits

  • Functional comparative analysis:

    • Enzymatic parameters across species:

      ParameterMethodologyExpected Interspecies Variation
      K𝑚 for NADHSpectrophotometric assays10-30% variation
      V𝑚𝑎𝑥Initial velocity measurements2-3 fold differences
      Inhibitor sensitivityIC₅₀ determinationOrder of magnitude differences
      Proton pumping efficiencypH-sensitive fluorescence20-40% variation
      Temperature optimaActivity at temperature rangeReflects ecological niche
      pH toleranceActivity across pH rangeSpecies-specific adaptation
  • Adaptation to environmental conditions:

    • Temperature adaptation markers:

      • Cold-adapted species: higher catalytic efficiency at lower temperatures

      • Heat-adapted species: enhanced structural stability, altered lipid interactions

    • Oxidative stress resistance:

      • Species-specific ROS production rates

      • Structural features protecting against oxidative damage

    • Host-specific adaptations:

      • Variations correlating with preferred host environments (pH, metabolite availability)

      • Immune evasion strategies related to mitochondrial function

  • Methodological approach for comparative studies:

    • Standardized expression systems for multiple species

    • Identical purification protocols to eliminate methodology-based variations

    • Side-by-side functional characterization under identical conditions

    • Structural analysis using consistent techniques (Cryo-EM preferred)

  • Evolutionary implications:

    • Dating gene divergence using molecular clock approaches

    • Correlating functional changes with speciation events

    • Identifying convergent evolution patterns across distant Leishmania lineages

    • Mapping metabolic adaptations to host switching events

This comparative approach provides a powerful framework for understanding how mitochondrial proteins like ND5 have evolved across Leishmania species, offering insights into adaptation mechanisms and potentially identifying species-specific vulnerabilities for targeted therapeutic development. Similar comparative approaches examining immune responses to different Leishmania species have been valuable in previous research .

How can recombinant Leishmania tarentolae ND5 contribute to understanding resistance mechanisms against anti-leishmanial drugs targeting mitochondria?

Recombinant L. tarentolae ND5 provides a powerful platform for investigating resistance mechanisms against mitochondria-targeting anti-leishmanial drugs:

  • Molecular basis of resistance investigation:

    • Site-directed mutagenesis approach:

      • Introduction of mutations observed in drug-resistant clinical isolates

      • Systematic mutation of predicted drug-binding residues

      • Creation of chimeric proteins between resistant and sensitive species

      • Alanine-scanning mutagenesis of transmembrane domains

    • Structural analysis of resistance mutations:

      • Mapping mutations on 3D structural models

      • Molecular dynamics simulations of drug binding to wild-type vs. mutant proteins

      • Binding energy calculations and residence time predictions

      • Conformational changes induced by resistance mutations

  • Biochemical characterization of resistant variants:

    • Comparative enzyme kinetics:

      ParameterWild-type ND5Resistant ND5 VariantExperimental Approach
      Basal enzyme activityBaselineOften slightly reducedNADH oxidation assays
      Drug binding affinityK𝑑 in nM-μM rangeSignificantly reducedIsothermal titration calorimetry
      IC₅₀ valuesBaseline10-1000× higherDose-response curves
      Catalytic efficiencyBaselineVariable (fitness cost)k𝑐𝑎𝑡/K𝑚 determination
      Proton translocationCoupled to catalysisPotentially uncoupledpH-sensitive dye measurements
  • Compensatory mechanisms identification:

    • Alternative electron transport pathways:

      • Alternative NADH dehydrogenases upregulation

      • Cytochrome bd oxidase expression

      • Glycolytic flux adjustments

    • Mitochondrial membrane adaptations:

      • Altered phospholipid composition

      • Changed membrane fluidity

      • Modified supercomplex formation

  • Resistance transfer and validation:

    • CRISPR/Cas9-mediated introduction of resistance mutations

    • Heterologous expression of resistant ND5 variants

    • Cross-resistance profiling against multiple drug classes

    • Fitness cost assessment in the absence of drug pressure

  • Translational applications:

    • Rational design of second-generation inhibitors evading resistance

    • Development of combination therapies targeting multiple mitochondrial components

    • High-throughput screening for resistance-breaking compounds

    • Predictive biomarkers for clinical resistance

This systematic approach using recombinant ND5 variants enables detailed mechanistic understanding of how Leishmania parasites develop resistance to mitochondria-targeting drugs, ultimately informing more effective therapeutic strategies. The experimental design principles align with those used in previous Leishmania research investigating immune responses and protein function .

What emerging technologies could revolutionize the structural characterization of recombinant Leishmania tarentolae ND5?

Several cutting-edge technologies are poised to transform our understanding of L. tarentolae ND5 structure and dynamics:

  • Advanced cryo-electron microscopy applications:

    • Micro-electron diffraction (MicroED) for crystalline membrane protein samples

    • Time-resolved cryo-EM to capture conformational states during catalysis

    • Cryo-electron tomography of ND5 in native mitochondrial membranes

    • Correlative light and electron microscopy for in situ structural studies

    • Focused ion beam milling combined with cryo-ET for visualizing ND5 in intact cells

  • Innovative spectroscopic methods:

    • Advanced EPR techniques for investigating iron-sulfur clusters:

      • Double electron-electron resonance (DEER) for measuring distances

      • Hyperfine sublevel correlation (HYSCORE) for identifying cluster ligands

    • Solid-state NMR methodologies for membrane-embedded ND5

    • Synchrotron radiation circular dichroism for high-precision secondary structure analysis

    • Infrared spectroscopy for proton-pumping mechanism elucidation

  • Single-molecule biophysical approaches:

    TechnologyApplication to ND5Expected ResolutionTechnical Requirements
    Single-molecule FRETConformational dynamics2-8 nm distance changesSite-specific labeling
    Magnetic tweezersMechanical propertiespN force sensitivityTethering strategies
    Nanodiscs with AFMTopographical featuresSub-nm vertical resolutionReconstitution protocols
    Nanopore technologyConformational statesμs temporal resolutionPore engineering
    Optical tweezersProtein folding/unfoldingpN force resolutionSurface attachment
  • Computational and AI-enhanced approaches:

    • AlphaFold2 and RoseTTAFold for accurate structure prediction

    • Molecular dynamics simulations with enhanced sampling:

      • Gaussian accelerated molecular dynamics

      • Replica exchange with solute tempering

    • Machine learning for identifying functional motifs across species

    • Quantum mechanics/molecular mechanics for catalytic mechanism elucidation

    • Network analysis of allosteric communication pathways

  • Integrative structural biology frameworks:

    • Combining complementary techniques (cryo-EM, crosslinking mass spectrometry, SAXS)

    • Time-resolved studies capturing the catalytic cycle

    • In-cell structural biology approaches

    • Native mass spectrometry for complex integrity analysis

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

These emerging technologies will enable unprecedented insights into ND5 structure and function, particularly regarding conformational changes during the catalytic cycle, proton-pumping mechanisms, and interactions with other Complex I subunits. The application of these advanced structural approaches could build upon the molecular biology techniques already established for Leishmania protein expression and characterization .

What are the potential applications of recombinant Leishmania tarentolae ND5 beyond basic research?

Recombinant L. tarentolae ND5 offers several promising applications extending beyond fundamental research:

  • Therapeutic development platforms:

    • Drug discovery applications:

      • High-throughput screening target for novel anti-leishmanials

      • Structure-based drug design against a validated mitochondrial target

      • Development of species-specific inhibitors with reduced host toxicity

      • Rational design of drugs targeting resistance-associated mutations

    • Immunological applications:

      • Potential subunit vaccine component against leishmaniasis

      • T-cell epitope mapping and immunodominant region identification

      • Development of immune-modulatory strategies targeting mitochondrial antigens

      • Design of chimeric immunogens incorporating protective ND5 epitopes

  • Biotechnological applications:

    • Bioenergetic engineering:

      ApplicationMethodologyPotential Impact
      Enhanced bioproductionIntegration into production strains15-30% yield increase
      Optimized electron transportEngineered ND5 variantsReduced ROS production
      Biofuel cellsElectrode-immobilized ND5Improved catalytic efficiency
      Synthetic ATP productionReconstituted systemsControllable energy generation
    • Biosensor development:

      • NADH/NAD⁺ ratio detection systems

      • Mitochondrial toxicity screening platforms

      • Environmental contaminant detection (pesticides targeting Complex I)

      • Immobilized ND5-based electrochemical sensors

  • Diagnostic applications:

    • Development of serological tests based on species-specific ND5 epitopes

    • Identification of biomarkers for drug resistance in clinical isolates

    • PCR-based species differentiation targeting ND5 sequence variations

    • Immunochromatographic rapid tests for field diagnosis

  • Agricultural and veterinary applications:

    • Development of parasite-specific inhibitors for veterinary medicine

    • Cross-protection strategies for related livestock parasites

    • Understanding mitochondrial targets in arthropod vectors

    • Design of environmentally friendly insecticides targeting arthropod Complex I

  • Educational and research tool applications:

    • Model system for teaching mitochondrial biology

    • Standardized research tool for comparing mitochondrial function

    • Reference protein for developing membrane protein methodologies

    • Quality control standard for mitochondrial assays

These diverse applications highlight how research on recombinant L. tarentolae ND5 can translate into practical tools and technologies with significant impact across multiple fields. The development of such applications would build upon the expression and characterization methodologies established for other recombinant Leishmania proteins .

How might CRISPR-Cas9 gene editing transform research on Leishmania tarentolae ND5?

CRISPR-Cas9 technology offers revolutionary potential for advancing L. tarentolae ND5 research through precise genetic manipulation:

  • Advanced genetic manipulation strategies:

    • Endogenous modification approaches:

      • Precise introduction of point mutations to study structure-function relationships

      • Insertion of epitope tags for tracking native ND5 without overexpression artifacts

      • Creation of fluorescent protein fusions for real-time localization studies

      • Introduction of regulatory elements for controlled expression

      • Base editing for introducing subtle changes without double-strand breaks

    • Functional genomics applications:

      • Conditional knockdown systems (CRISPRi) for essential gene analysis

      • Creation of complete knockout lines with complementation

      • Multiplexed editing to modify multiple Complex I subunits simultaneously

      • Saturating mutagenesis of key domains for comprehensive functional mapping

  • Precise experimental systems development:

    • Humanized Leishmania models:

      Modification TypeMethodologyResearch Application
      Chimeric ND5Domain swapping with human ND5Drug selectivity studies
      Resistance mutationsIntroduction of human polymorphismsDisease-related variants analysis
      Reporter knock-insFusion to split fluorescent proteinsAssembly dynamics visualization
      Regulatory elementsHuman promoter/UTR replacementExpression regulation studies
    • Disease model engineering:

      • Introduction of mutations identified in drug-resistant field isolates

      • Recreation of natural genetic diversity observed across strains

      • Modifications mimicking adaptations to different hosts

      • Engineering reporter strains for in vivo imaging

  • High-throughput functional genomics:

    • CRISPR screening approaches:

      • Genome-wide screens for synthetic lethality with ND5 inhibition

      • Focused screens targeting mitochondrial function

      • Chemical-genetic interaction mapping

      • Identification of resistance mechanisms through gain-of-function screens

    • Systematic mutagenesis:

      • Alanine scanning of entire ND5 coding sequence

      • Deep mutational scanning coupled with functional selection

      • Guide RNA libraries targeting regulatory elements

      • Combinatorial mutagenesis of interacting residues

  • Advanced expression platform development:

    • Optimized recombinant production:

      • Integration of inducible expression cassettes at safe harbor loci

      • Engineering of dedicated protein production strains

      • Creation of strains with humanized membrane composition

      • Development of secretion systems for simplified purification

  • Translational research applications:

    • Validation of drug mechanisms and targets

    • In vivo tracking of genetically marked parasites

    • Development of attenuated vaccine strains

    • Creation of biosensor parasites for drug screening

The implementation of CRISPR-Cas9 technology creates unprecedented opportunities for precise, systematic investigation of L. tarentolae ND5 biology, potentially accelerating progress in understanding this protein's structure, function, and potential as a therapeutic target. Similar molecular biology approaches for genetic manipulation would build upon the recombinant expression techniques already established for Leishmania proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.