Recombinant Lemna minor Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Lemna minor (Common duckweed)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQSVLPDTVFEAVVRIPYDTQVKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNISFQSYSPTKKNILVIGPVPG QKYREIVFPILSPDPATSKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGVVS KIVRKEKKGYEIIITDPSDGREVVDIIPPGPELLVSEGESIKLDQLLTSNPNVGGFGQGD AEIVLQDPSRVQGLLFFLASVVLAQIFLVLKKKQFEKVQLFEMNF
Uniprot No.

Target Background

Function
Recombinant Lemna minor Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Lemna minor and why is it significant in scientific research?

Lemna minor (common duckweed) is a small floating aquatic plant widely used in scientific research due to its simple structure, rapid growth rate, and ease of laboratory cultivation. It belongs to the Lemnaceae family, which includes some of the smallest and simplest flowering plants. Lemna species are particularly valuable as model organisms for studying plant physiology, toxicology, and biochemical pathways.

Lemna minor has become increasingly important in genomic studies, with recent sequencing efforts revealing unique adaptations to aquatic environments. Research has shown that Lemna minor exhibits distinct metabolic responses to environmental stressors such as pharmaceutical compounds, activating specific pathways including flavonoid production and alterations to chlorophyll metabolism . Its compact genome and rapid reproduction cycle make it ideal for studying fundamental plant processes including photosynthesis, in which apocytochrome f plays a crucial role.

What is apocytochrome f and what is its function in photosynthesis?

Apocytochrome f is the precursor protein form of cytochrome f, encoded by the petA gene in the chloroplast genome. The mature cytochrome f is a critical component of the cytochrome b6f complex, which functions as an electron carrier in the photosynthetic electron transport chain between photosystems II and I.

The biosynthesis of functional cytochrome f involves a multistep process that includes:

  • Translation of the petA gene to produce apocytochrome f precursor

  • Processing of the precursor protein by thylakoid processing peptidase

  • Covalent attachment of a c-type heme group

  • Membrane insertion and assembly into the cytochrome b6f complex

Research has demonstrated that in the mature protein, one axial ligand of the c-heme is provided by the alpha-amino group of Tyr1, which is only exposed after cleavage of the signal sequence from the precursor protein . This structural arrangement is essential for proper electron transport function.

How is the petA gene organized and regulated in Lemna minor?

The petA gene in Lemna minor is located in the chloroplast genome and encodes the apocytochrome f precursor protein. Recent genomic studies have provided valuable insights into the organization of this gene in Lemnaceae species.

In Lemna minor, the petA gene contains coding sequences for a protein of approximately 320 amino acids. The full sequence includes regions encoding:

  • A transit peptide for chloroplast targeting

  • The mature protein domain that includes conserved cysteine residues crucial for heme attachment

  • A C-terminal membrane anchor domain

Comparative genomic analyses between Lemna species and other plants in the Lemnaceae family (including Spirodela and Wolffia) have revealed conserved syntenic relationships, allowing researchers to consistently number and orient the Lemna chromosomes . Genome sequencing has also identified variations in the genomic context of petA among different Lemna species and accessions, particularly in interspecific hybrids like L. japonica .

The expression of petA is regulated as part of the chloroplast gene expression machinery and can be influenced by nuclear-encoded factors. Studies in Arabidopsis thaliana have identified RNA binding pentatricopeptide repeat proteins involved in the processing of chloroplast transcripts including those in the psbB-psbT-psbH-petB-petD region, which may have similar regulatory mechanisms in Lemna minor .

What expression systems are most effective for producing recombinant Lemna minor apocytochrome f?

Producing functional recombinant apocytochrome f from Lemna minor requires careful consideration of expression systems that can accommodate the protein's structural requirements and post-translational modifications. Based on established protocols for similar proteins, the following expression systems have proven effective:

Bacterial Expression Systems:

  • E. coli can be used for producing the unmodified apocytochrome f protein

  • Specialized strains with enhanced disulfide bond formation may improve proper folding

  • Codon optimization for the Lemna minor sequence is essential for efficient expression

Algal and Plant-Based Systems:

  • Chlamydomonas reinhardtii has been successfully used for cytochrome f studies through chloroplast transformation

  • Homologous expression in Lemna minor itself via chloroplast transformation

  • Transient expression in Nicotiana benthamiana for preliminary structural studies

For successful expression and purification, the recombinant protein should include appropriate tags to facilitate purification while minimizing interference with protein folding. Storage conditions should include a Tris-based buffer with 50% glycerol as used for commercial preparations .

How can researchers verify the structural integrity and functionality of recombinant apocytochrome f?

Verifying the structural integrity and functionality of recombinant apocytochrome f involves multiple analytical approaches:

Structural Verification Methods:

  • SDS-PAGE and Western blotting to confirm protein size and identity

  • Circular dichroism spectroscopy to assess secondary structure elements

  • UV-visible absorption spectroscopy to verify heme incorporation (if processing to holocytochrome f occurs)

  • Mass spectrometry to confirm protein mass and potential post-translational modifications

Functional Assays:

  • Electron transfer capacity measurements using artificial electron donors and acceptors

  • Assembly competence into cytochrome b6f complexes (in appropriate systems)

  • Reconstitution experiments with isolated thylakoid membranes

Research has demonstrated that pre-apocytochrome f adopts a suitable conformation for the cysteinyl residues to be substrates of the heme lyase, and pre-holocytochrome f can fold into an assembly-competent conformation even when processing is delayed or impaired . This provides flexibility in experimental approaches when working with the recombinant protein.

What site-directed mutagenesis strategies have been most informative for studying apocytochrome f structure-function relationships?

Site-directed mutagenesis has been instrumental in elucidating the structure-function relationships in apocytochrome f. Several strategic approaches have yielded significant insights:

Key Mutagenesis Targets and Their Effects:

Target SiteMutationObserved EffectResearch Significance
Cysteinyl residues for heme attachmentCys → Val/LeuPrevents heme bindingDemonstrated that heme binding is not a prerequisite for protein processing
Processing site (AQA sequence)AQA → LQLDelayed processingShowed that both precursor and processed forms can bind heme and assemble into complexes
Tyr1 (exposed after processing)Tyr → PheAltered heme coordinationRevealed the importance of the α-amino group in heme coordination
C-terminal membrane anchorTruncationIncreased synthesis rateDemonstrated regulatory role of the membrane anchor in protein synthesis

These mutagenesis approaches have been successfully implemented through chloroplast transformation systems, particularly in model organisms like Chlamydomonas reinhardtii . The mutations have revealed the remarkable flexibility in the biosynthetic pathway of cytochrome f, showing that processing and heme attachment can occur somewhat independently and in different orders.

How does Lemna minor apocytochrome f compare to homologs in other photosynthetic organisms?

Comparative analyses of apocytochrome f across different photosynthetic organisms have revealed both conserved features essential for function and species-specific adaptations:

Sequence Conservation Analysis:
The amino acid sequence of Lemna minor apocytochrome f (UniProt: A9L9A9) shows high conservation in functional domains compared to other photosynthetic organisms . The mature protein contains approximately 285 amino acids with key conserved features including:

  • The N-terminal domain with the heme-binding CXXCH motif

  • The small domain containing a conserved beta-sheet structure

  • The C-terminal membrane anchor

Structural Comparisons:
When comparing the predicted structure of Lemna minor apocytochrome f with experimentally determined structures from other organisms, several features stand out:

These comparisons have implications for understanding the evolution of photosynthetic electron transport across plant lineages and may inform engineering efforts to optimize photosynthetic efficiency in different environments.

What role does apocytochrome f play in the unique adaptations of Lemna minor to aquatic environments?

Lemna minor has evolved specific adaptations to its aquatic lifestyle, and apocytochrome f plays a role in these adaptations through its function in photosynthetic electron transport:

Environmental Adaptation Mechanisms:

  • Fluctuating Light Conditions: Lemna minor must adapt to variable light conditions in aquatic environments. Research on photosynthetic acclimation in fluctuating light environments suggests that cytochrome b6f complex (including cytochrome f) regulation is a key control point .

  • Stress Response Integration: Studies on Lemna minor exposed to pharmaceutical compounds have shown alterations in photosynthetic pathways. When incubated with diclofenac, Lemna minor exhibits enhanced flavonoid production and modifications to chlorophyll degradation pathways , suggesting a link between stress responses and photosynthetic electron transport regulation.

  • Genomic Adaptations: Analysis of the Lemna minor genome reveals unique adaptations that may influence petA expression and function. The genome shows evidence of potential holocentricity in chromosomes, which could affect gene regulation patterns .

These adaptations represent evolutionary solutions to the challenges of aquatic photosynthesis and may provide insights into strategies for engineering enhanced photosynthetic efficiency in other plant systems.

How can hybrid genomic studies inform our understanding of petA gene evolution in Lemnaceae?

Recent genomic studies have revealed fascinating insights into petA gene evolution through analysis of hybrid Lemna species:

Hybrid Genomic Architecture:
Genomic analyses of Lemna japonica interspecific hybrids have revealed that they form with variable parental dosage as diploids and reciprocal triploids . These hybrids contain genetic material from both L. minor and L. turionifera, allowing researchers to examine how the petA gene behaves in these hybrid contexts.

Chromosomal Organization and Synteny:
Comparisons between Lemna, Wolffia, and Spirodela have determined syntenic relationships across the Lemnaceae family . These analyses have enabled consistent numbering and orientation of Lemna chromosomes, providing a framework for understanding the genomic context of petA.

Evolutionary Implications:
Triploid hybrids arise commonly among Lemna species, and researchers have identified mutations in highly-conserved meiotic crossover genes that could support polyploid meiosis . This suggests unique evolutionary mechanisms in Lemnaceae that may influence the expression and function of chloroplast genes like petA.

The study of these hybrid genomes provides valuable insights into the evolutionary history of petA and may inform our understanding of how photosynthetic electron transport components adapt during speciation and hybridization events.

What are the optimal conditions for storage and handling of recombinant Lemna minor apocytochrome f?

Proper storage and handling of recombinant Lemna minor apocytochrome f is critical for maintaining protein stability and functionality:

Storage Recommendations:

  • Store at -20°C for regular use, or at -80°C for extended storage

  • Maintain in a Tris-based buffer supplemented with 50% glycerol

  • Avoid repeated freeze-thaw cycles; instead, prepare working aliquots

  • For short-term use, working aliquots can be stored at 4°C for up to one week

Handling Considerations:

  • When working with the protein, use buffers optimized for stability

  • Consider including protease inhibitors to prevent degradation

  • For experimental applications, maintain reducing conditions to preserve cysteine residues required for potential heme attachment

  • If studying the membrane-bound form, appropriate detergents may be necessary to maintain the native conformation of the C-terminal domain

These conditions have been optimized to maintain the structural integrity of the protein while preserving its potential for functional studies.

What analytical techniques are most informative for studying protein-protein interactions involving apocytochrome f?

Understanding the protein-protein interactions of apocytochrome f is essential for elucidating its role in photosynthetic complexes. Several analytical techniques have proven particularly valuable:

In Vitro Techniques:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentifying binding partnersPreserves native interactionsMay miss transient interactions
Surface plasmon resonanceMeasuring binding kineticsReal-time binding analysisRequires protein immobilization
Isothermal titration calorimetryThermodynamic analysisLabel-free, quantitativeRequires significant amounts of purified protein
Cross-linking mass spectrometryMapping interaction interfacesIdentifies specific contact residuesMay introduce artifacts

In Vivo Approaches:

  • Split fluorescent protein complementation - For visualizing interactions in living cells

  • Förster resonance energy transfer (FRET) - For studying proximity and dynamics

  • Genetic suppressor analysis - For identifying functional relationships

These techniques have been applied to study how apocytochrome f interacts with components of the cytochrome b6f complex and with proteins involved in its biogenesis, such as the heme lyase and thylakoid processing peptidase .

What are the key considerations when designing experiments to study apocytochrome f processing and maturation?

Studying the processing and maturation of apocytochrome f requires careful experimental design to capture the multistep process:

Critical Experimental Design Factors:

  • Choice of expression system:

    • Chloroplast transformation systems (as used in Chlamydomonas) provide a native-like environment

    • Heterologous systems require appropriate processing enzymes

  • Temporal resolution:

    • Pulse-chase experiments can capture the kinetics of processing

    • Time-course sampling is essential for observing intermediate forms

  • Detection methods:

    • Antibodies specific to different regions (N-terminal, heme-binding domain, C-terminal)

    • Spectroscopic methods to detect heme incorporation

    • Gel systems capable of resolving small changes in molecular weight

  • Mutation strategies:

    • Site-directed mutations at the processing site (demonstrated with AQA→LQL substitution)

    • Mutations affecting heme attachment (cysteine substitutions)

    • C-terminal modifications to study membrane insertion

Research has shown that processing and heme attachment can occur somewhat independently, with pre-apocytochrome f capable of adopting a conformation suitable for heme attachment, and pre-holocytochrome f capable of assembling into functional complexes . This flexibility should be considered when designing experiments to study specific aspects of maturation.

How might CRISPR/Cas9 technology be applied to study petA function in Lemna minor?

CRISPR/Cas9 technology offers powerful new approaches for studying petA function in Lemna minor through precise genome editing:

Potential CRISPR/Cas9 Applications:

  • Precise gene editing:

    • Introduction of specific mutations to study structure-function relationships

    • Creation of tagged versions of apocytochrome f for in vivo tracking

    • Generation of conditional knockdown lines to study essential functions

  • Regulatory element analysis:

    • Modification of promoter regions to study transcriptional regulation

    • Alteration of RNA processing sites to investigate post-transcriptional control

  • Technical considerations for Lemna minor:

    • Optimized transformation protocols for duckweed species

    • Appropriate selection markers compatible with aquatic cultivation

    • Strategies for distinguishing between nuclear and chloroplast genome editing

These approaches could complement traditional chloroplast transformation methods and provide new insights into petA function in the context of the unique biology of Lemna minor.

What insights might comparative analyses of petA across Lemnaceae species provide about photosynthetic adaptation?

Comparative analysis of petA across the Lemnaceae family offers a valuable opportunity to understand photosynthetic adaptation in aquatic environments:

Research Opportunities:

  • Evolutionary adaptation analysis:

    • Molecular evolution rates in petA compared to other photosynthetic genes

    • Correlation between sequence variations and ecological niches

    • Identification of positively selected residues that may confer adaptive advantages

  • Structural and functional comparisons:

    • Variations in protein processing efficiency between species

    • Differences in electron transfer kinetics

    • Adaptations to varying light conditions in different aquatic habitats

  • Genomic context analysis:

    • Comparison of syntenic relationships across Lemnaceae species

    • Analysis of genome rearrangements affecting petA regulation

    • Examination of hybrid species to understand petA evolution during speciation

Such comparative analyses could leverage the recent availability of genome sequences for multiple Lemnaceae species, including Lemna minor, Lemna japonica hybrids, Wolffia, and Spirodela .

How might structural studies of Lemna minor apocytochrome f contribute to photosynthesis engineering efforts?

Detailed structural studies of Lemna minor apocytochrome f could inform efforts to engineer enhanced photosynthesis in crop plants:

Engineering Applications:

  • Optimizing electron transport:

    • Identifying rate-limiting steps in electron flow

    • Engineering variants with altered redox properties

    • Modifying protein-protein interactions to enhance complex assembly

  • Stress tolerance improvements:

    • Understanding how structural features contribute to function under stress

    • Identifying modifications that enhance stability under varying conditions

    • Engineering variants with improved ROS handling capabilities

  • Synthetic biology approaches:

    • Designing minimal functional versions for incorporation into artificial photosynthetic systems

    • Creating chimeric proteins with enhanced or novel functions

    • Developing optogenetic tools based on cytochrome structural elements

These engineering efforts could benefit from Lemna minor's natural adaptations to aquatic environments, which may include unique solutions to photosynthetic challenges that could be transferred to terrestrial crop plants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.