Recombinant Lemna minor NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Lemna minor (Common duckweed)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLVISSVIPILAFIISGVLAPLSEGPEKLSSYESGIEPIGDAWVQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGSVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of NAD(P)H-quinone oxidoreductase subunit 3 in Lemna minor?

    NAD(P)H-quinone oxidoreductase subunit 3 in Lemna minor (Common duckweed) is a chloroplastic protein that functions as part of the NAD(P)H dehydrogenase complex. This enzyme catalyzes the electron transfer from NAD(P)H to quinones, playing a crucial role in cellular redox reactions and protection against oxidative stress. The protein is encoded by the ndhC gene and is classified under EC 1.6.5.-, indicating its function in oxidoreductase activity . Structurally, it contains transmembrane domains characteristic of membrane-bound proteins, with hydrophobic regions that anchor it within the chloroplast membrane. The protein participates in cyclic electron flow around photosystem I, which is critical for balancing the ATP/NADPH ratio during photosynthesis in adverse environmental conditions.

  • How should researchers prepare and store recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 3 for experimental use?

    For optimal preparation and storage of recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 3, researchers should follow these evidence-based protocols:

    • Store the protein at -20°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein

    • For extended storage periods, conserve samples at -80°C to minimize degradation

    • Avoid repeated freezing and thawing cycles, which can significantly compromise protein stability and activity

    • Prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles

    • When handling the protein, maintain aseptic techniques similar to those used in Lemna minor culture maintenance to prevent contamination

    This storage regimen is designed to preserve the structural integrity and enzymatic activity of the protein for research applications.

  • How does Lemna minor growth environment affect the expression of NAD(P)H-quinone oxidoreductase subunit 3?

    The expression of NAD(P)H-quinone oxidoreductase subunit 3 in Lemna minor is significantly influenced by environmental conditions. Research indicates that:

    • Temperature variations impact gene expression patterns, with temperature stress potentially triggering epigenetic modifications that affect ndhC expression

    • Standardized growth conditions for experimental work typically maintain Lemna minor at 24 ± 0.2°C with light intensity of 100 ± 10 μmol m⁻² s⁻¹

    • Nutrient availability affects metabolic profiles and potentially enzyme expression, with different extraction methods (100% MeOH, 50% MeOH, and 100% H₂O) yielding distinct metabolite patterns that may correlate with oxidoreductase expression levels

    • Population density considerations are important, as overcrowding can induce stress responses that alter gene expression profiles

    When designing experiments involving NAD(P)H-quinone oxidoreductase subunit 3, researchers should carefully control and document environmental parameters to ensure reproducibility of results.

  • What analytical methods are most effective for confirming the identity and purity of recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 3?

    For rigorous confirmation of identity and purity, researchers should employ a multi-method analytical approach:

    • SDS-PAGE for molecular weight confirmation and initial purity assessment

    • Western blotting with antibodies specific to the protein or affinity tag

    • Mass spectrometry (MS) for precise molecular weight determination and peptide mapping

    • Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) for comprehensive protein characterization

    • Activity assays measuring NAD(P)H oxidation rates in the presence of quinone substrates

    • Circular dichroism (CD) spectroscopy to verify proper protein folding

    When using mass spectrometry, researchers can employ similar approaches to those used for Lemna minor metabolomics, where TOF-MS and QTOF-MS/MS systems have been successfully applied for compound identification . For comprehensive characterization, both intact protein analysis and peptide mapping following enzymatic digestion should be performed.

Advanced Research Questions

  • How does the enzymatic mechanism of Lemna minor NAD(P)H-quinone oxidoreductase subunit 3 compare with homologous enzymes in other organisms?

    The enzymatic mechanism of Lemna minor NAD(P)H-quinone oxidoreductase subunit 3 involves a two-electron reduction of quinones that prevents the formation of semiquinone radicals. This mechanism shares fundamental similarities with NQO1 in mammals but with important distinctions:

    ParameterLemna minor ndhCMammalian NQO1Bacterial NDH
    Electron transferTwo-electron reductionTwo- or four-electron reductionVariable
    Subcellular locationChloroplasticCytosolic/mitochondrialMembrane-bound
    Cofactor preferenceNAD(P)HNADH or NADPH with similar efficiencyNADH preferred
    Physiological rolePhotosynthetic electron transportDetoxification/antioxidantRespiratory chain
    Inhibitor sensitivityMay differ from mammalian enzymesDicumarol sensitiveVariable by species

    Unlike mammalian NQO1, which has been extensively studied for its role in preventing oxidative stress through reduction of quinones like menadione, alpha-tocopherol quinone, and benzene quinones , the chloroplastic NAD(P)H-quinone oxidoreductase in Lemna minor is primarily involved in cyclic electron flow during photosynthesis. This functional specialization likely reflects evolutionary adaptations to different cellular environments and metabolic requirements.

  • What methodologies are most effective for studying the enzymatic activity of recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 3?

    Effective methodologies for studying enzymatic activity include:

    • Spectrophotometric assays monitoring NAD(P)H oxidation at 340 nm

    • High-performance liquid chromatography (HPLC) to quantify substrate conversion and product formation

    • Oxygen consumption measurements using Clark-type electrodes to assess potential oxidative side reactions

    • Chemiluminescence assays to detect reactive oxygen species generation during enzyme function

    • Electrochemical methods to characterize electron transfer processes

    For comprehensive kinetic characterization, researchers should determine:

    1. Substrate specificity using various quinone substrates

    2. Kinetic parameters (Km, Vmax, kcat) under varying pH and temperature conditions

    3. Inhibition profiles using known quinone oxidoreductase inhibitors like dicumarol

    4. The effects of potential activators or stabilizers on enzyme function

    The chemiluminescence assay approach has been particularly informative in similar systems, where the oxygen-dependent emission of red light during quinone redox cycling can be measured to assess enzyme activity in reducing menadione and preventing one-electron reduction pathways .

  • How can researchers differentiate between the functions of different NAD(P)H-quinone oxidoreductase isoforms in Lemna minor?

    Differentiating between NAD(P)H-quinone oxidoreductase isoforms requires a multi-faceted approach:

    • Gene-specific RNA interference (RNAi) constructs targeting individual isoforms, similar to the approach used for modifying glycosylation enzymes in Lemna minor

    • CRISPR-Cas9 gene editing to create knockout or modified variants of specific isoforms

    • Isoform-specific antibodies for immunolocalization studies

    • Expression of recombinant isoforms followed by comparative biochemical characterization

    • Metabolomic analysis to identify isoform-specific metabolite signatures

    A systematic experimental design should include:

    1. Transcriptomic analysis to identify expression patterns of all isoforms under various conditions

    2. Subcellular fractionation to determine precise localization of each isoform

    3. Activity assays with isoform-selective substrates or inhibitors

    4. Complementation studies in which individual isoforms are expressed in knockout backgrounds

    This comprehensive approach allows researchers to build a detailed understanding of the specialized roles of different NAD(P)H-quinone oxidoreductase isoforms in Lemna minor metabolism and stress response.

  • What role does DNA methylation play in regulating NAD(P)H-quinone oxidoreductase expression in Lemna minor under environmental stress?

    DNA methylation appears to be a significant epigenetic mechanism regulating gene expression in Lemna minor, potentially including NAD(P)H-quinone oxidoreductase genes:

    • Research on clonal Lemna minor lineages demonstrates that DNA methylation variants may mediate gene expression responses to environmental changes

    • The asexual reproduction of Lemna minor circumvents germline resetting of epigenetic marks, potentially allowing for longer-term inheritance of stress-induced epigenetic modifications

    • Temperature stress has been shown to induce changes in DNA methylation patterns in Lemna minor, which could affect the expression of stress-responsive genes like those encoding NAD(P)H-quinone oxidoreductase

    To investigate this regulatory mechanism specifically for NAD(P)H-quinone oxidoreductase, researchers should:

    1. Perform bisulfite sequencing of promoter regions under various stress conditions

    2. Correlate methylation patterns with gene expression levels using RT-qPCR

    3. Apply demethylating agents to determine if expression changes can be reversed

    4. Investigate the transgenerational stability of stress-induced methylation patterns in asexually propagated populations

    This approach would provide insights into how environmental factors influence NAD(P)H-quinone oxidoreductase expression through epigenetic mechanisms, potentially revealing novel aspects of stress adaptation in Lemna minor.

  • How can metabolomics approaches be integrated with proteomics to understand the role of NAD(P)H-quinone oxidoreductase in Lemna minor metabolism?

    An integrated metabolomics-proteomics approach offers powerful insights into NAD(P)H-quinone oxidoreductase function:

    ApproachApplication to NAD(P)H-quinone oxidoreductase researchTechnical considerations
    Untargeted metabolomicsIdentify metabolite changes associated with enzyme activityRequires extraction optimization with multiple solvents (100% MeOH, 50% MeOH, 100% H₂O)
    Targeted metabolomicsQuantify specific quinones and related metabolitesEnhanced sensitivity for low-abundance compounds
    Shotgun proteomicsIdentify protein interaction networksRequires effective protein extraction from plant material
    Quantitative proteomicsMeasure enzyme abundance under different conditionsCan use label-free or isotope labeling approaches
    Integrative analysisCorrelate metabolite levels with enzyme abundanceRequires sophisticated bioinformatics tools

    Implementation should follow the workflow established for Lemna minor metabolomics , which includes:

    1. Sample preparation optimized for both metabolite and protein extraction

    2. LC-MS/MS analysis using both HILIC and RPLC separation modes

    3. Feature extraction and statistical analysis to identify significant changes

    4. Pathway mapping integrating metabolite and protein data

    This integrated approach would reveal how NAD(P)H-quinone oxidoreductase influences the metabolic landscape of Lemna minor, potentially identifying novel substrates, products, and regulatory relationships.

Research Applications and Methodological Considerations

  • What experimental approaches can be used to investigate the role of NAD(P)H-quinone oxidoreductase in protecting Lemna minor against oxidative stress?

    To investigate the protective role of NAD(P)H-quinone oxidoreductase against oxidative stress, researchers should consider these methodological approaches:

    • ROS detection assays using fluorescent probes (e.g., DCFH-DA, DHE) to measure reactive oxygen species levels under various conditions

    • Gene expression analysis comparing NAD(P)H-quinone oxidoreductase levels before and after oxidative stress exposure

    • Inhibitor studies using compounds that specifically target NAD(P)H-quinone oxidoreductase activity

    • Chemiluminescence assays to detect superoxide and singlet oxygen formation during quinone redox cycling

    • Measurement of lipid peroxidation products as markers of oxidative damage

    A comprehensive experimental design would involve:

    1. Exposing Lemna minor to oxidative stress conditions (e.g., high light, pollutants, quinones)

    2. Comparing wild-type plants with those modified to overexpress or suppress NAD(P)H-quinone oxidoreductase

    3. Measuring both enzyme activity and oxidative stress markers over time

    4. Analyzing the correlation between enzyme levels and stress resistance

    Similar approaches have demonstrated that induction of NQO1 levels decreases susceptibility to oxidative stress, while depletion increases susceptibility , suggesting that NAD(P)H-quinone oxidoreductase in Lemna minor likely plays a comparable protective role.

  • How can researchers optimize the expression and purification of recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 3 in heterologous systems?

    Optimizing heterologous expression requires addressing several key factors:

    • Expression system selection: While E. coli is commonly used, expression of membrane proteins may benefit from eukaryotic systems

    • Codon optimization: Adapting the coding sequence to the preferred codons of the expression host

    • Fusion tags: Incorporating affinity tags (His, GST, MBP) to facilitate purification and potentially improve solubility

    • Expression conditions: Optimizing temperature, induction timing, and media composition

    • Membrane protein considerations: Using detergents or amphipols for extraction and stabilization

    For purification, a multi-step protocol should include:

    1. Initial capture using affinity chromatography based on the incorporated tag

    2. Secondary purification using ion exchange or size exclusion chromatography

    3. Quality assessment via SDS-PAGE, Western blotting, and activity assays

    4. Storage in optimized buffer conditions (Tris-based buffer with 50% glycerol)

    Lemna minor itself could potentially be used as an expression system, as it has been successfully employed for producing recombinant proteins including monoclonal antibodies . This approach might be particularly valuable for chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 3, allowing expression in its native subcellular environment.

  • What approaches can researchers use to study structure-function relationships in Lemna minor NAD(P)H-quinone oxidoreductase subunit 3?

    Structure-function relationship studies require a comprehensive toolbox of techniques:

    • Homology modeling based on crystal structures of related proteins

    • Site-directed mutagenesis of predicted functional residues

    • Protein crystallization and X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for structural determination

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon substrate binding

    • Molecular dynamics simulations to predict protein behavior in membrane environments

    A systematic experimental approach should:

    1. Identify conserved residues through multiple sequence alignment with homologous proteins

    2. Generate a series of point mutations targeting potential catalytic and substrate-binding residues

    3. Assess the impact of mutations on enzyme kinetics and substrate specificity

    4. Correlate functional changes with structural predictions

    Researchers should be aware that the membrane-associated nature of this chloroplastic protein presents special challenges for structural studies, potentially requiring specialized approaches such as lipid nanodiscs or detergent micelles to maintain native-like environments during analysis.

  • How does Lemna minor NAD(P)H-quinone oxidoreductase activity correlate with the plant's adaptation to environmental stressors?

    The correlation between NAD(P)H-quinone oxidoreductase activity and environmental adaptation can be investigated through:

    • Comparative studies of enzyme activity across Lemna minor populations from different environments

    • Exposure experiments subjecting plants to various stressors (temperature, salinity, toxicants)

    • Time-course analyses of enzyme induction following stress exposure

    • Transcriptomic and proteomic profiling to place NAD(P)H-quinone oxidoreductase within broader stress response networks

    Research design considerations should include:

    1. Standardized growth conditions as baseline (24 ± 0.2°C, light intensity of 100 ± 10 μmol m⁻² s⁻¹)

    2. Controlled application of specific stressors followed by enzyme activity measurements

    3. Correlation of enzyme activity with physiological markers of stress tolerance

    4. Analysis of potential epigenetic regulation through DNA methylation studies

    The ability of Lemna minor to grow in various aquatic environments, including brackish water , suggests that NAD(P)H-quinone oxidoreductase may play a role in adaptation to challenging conditions, potentially through detoxification of quinones generated during oxidative stress or maintenance of electron transport chain efficiency under suboptimal conditions.

  • What are the potential biotechnological applications of recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 3?

    Potential biotechnological applications include:

    • Bioremediation of quinone-containing pollutants in aquatic environments

    • Biosensors for detecting quinone compounds in environmental samples

    • Biocatalysts for specific redox reactions in pharmaceutical synthesis

    • Model systems for studying plant responses to oxidative stress

    • Tool for understanding chloroplast electron transport engineering

    For these applications, research considerations include:

    1. Protein engineering to enhance stability or alter substrate specificity

    2. Immobilization techniques for creating reusable enzyme preparations

    3. Integration with other enzymes in biocatalytic cascades

    4. Development of standardized activity assays for quality control

    The success of expressing complex recombinant proteins in Lemna minor, as demonstrated with monoclonal antibodies , suggests that this plant could serve as both a source of NAD(P)H-quinone oxidoreductase and as a platform for producing engineered variants with enhanced properties for specific biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.