Recombinant Lemna minor NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

This subunit belongs to the NDH complex, which shuttles electrons from NAD(P)H to plastoquinone (PQ) in the thylakoid membrane . Key functions include:

ProcessMechanismOutcome
Electron TransportTransfers electrons via FMN and iron-sulfur (Fe-S) clusters to PQReduces PQ to plastoquinol (PQH₂)
Proton TranslocationCouples redox reactions to proton pumping across the thylakoid membraneGenerates a proton gradient for ATP synthesis
Chloroplast RespirationMay participate in a chloroplast respiratory chain, distinct from the main photosynthetic pathwayMaintains redox balance under stress conditions

The enzyme’s catalytic activity is defined as:
NAD(P)H+plastoquinoneNAD(P)++plastoquinol\text{NAD(P)H} + \text{plastoquinone} \rightarrow \text{NAD(P)}^+ + \text{plastoquinol}
(HAMAP-Rule MF_01456) .

Production and Purification

The recombinant protein is produced via heterologous expression in E. coli, followed by purification using affinity chromatography due to its His-tag .

ParameterDetails
Source OrganismLemna minor (chloroplastic)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder; store at -20°C/-80°C to avoid degradation.

Applications in Biotechnology

  • Enzymatic Assays: The recombinant protein is used in ELISA kits for detecting specific antibodies or studying protein-protein interactions .

  • Photosynthesis Research: Serves as a model to study NDH-mediated electron transport and stress responses in chloroplasts .

Comparative Analysis with Related Proteins

FeatureLemna minor Subunit 4LHuman NQO1Bacterial NDH-2
CofactorFAD/FMN (inferred)FADFAD or FMN
Substrate SpecificityPlastoquinoneBenzoquinones, mitomycinsUbiquinones
Proton TranslocationYes (photosynthetic electron transport)NoNo
Expression SystemChloroplast (recombinant in E. coli)Cytoplasmic (recombinant)Bacterial membranes

Challenges and Future Directions

  • Structural Elucidation: Crystallization and X-ray diffraction studies are needed to confirm cofactor binding and oligomeric structure.

  • Functional Redundancy: NDH’s role in chloroplast respiration vs. photosynthesis remains unclear, necessitating in vivo studies.

Table 1: Key Properties of Recombinant Lemna minor NAD(P)H-Quinone Oxidoreductase Subunit 4L

PropertyValue
UniProt IDA9L9E9
Gene NamendhE
Expression RegionFull-length (1–101 aa)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer (pH 8.0) with 6% trehalose

Table 2: Functional Domains

DomainFunction
Catalytic DomainBinds FAD/FMN and facilitates electron transfer from NAD(P)H to PQ
Proton ChannelMediates proton translocation across the thylakoid membrane
Subunit InteractionForms part of the NDH complex, interacting with other subunits (e.g., 4L, 5L)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Lemna minor (Common duckweed)
Target Names
ndhE
Target Protein Sequence
MMFEHVLFLSAYLFSIGIYGLITSRSMVRALMCLELILNSVNINLVTFSDLFDSRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSIRINQSNLLNK
Uniprot No.

Target Background

Function

NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems and conditions are optimal for recombinant production?

The primary expression system utilized for this protein is E. coli, which provides several advantages for membrane protein production including:

  • Rapid growth and high protein yields

  • Compatibility with His-tag purification systems

  • Well-established protocols for membrane protein expression

For optimal expression, the full-length protein (amino acids 1-101) is fused to an N-terminal His-tag, likely using a T7 or similar strong inducible promoter system . While the search results don't specify the exact E. coli strain, BL21(DE3) or its derivatives are typically used for membrane protein expression due to their protease deficiency and T7 polymerase compatibility.

What are the recommended storage and handling conditions?

To maintain protein stability and activity, the following storage and handling protocols are recommended:

  • Store lyophilized protein powder at -20°C/-80°C upon receipt

  • For reconstitution, centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to 5-50% final concentration (recommended 50%)

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

What is the biological function of NAD(P)H-quinone oxidoreductases in photosynthetic organisms?

NAD(P)H-quinone oxidoreductases play crucial roles in photosynthetic organisms through several mechanisms:

  • They catalyze the obligatory two-electron reduction of quinones to hydroquinones, preventing one-electron reduction that would generate harmful radical species .

  • In chloroplasts, these enzymes participate in:

    • Cyclic electron flow around photosystem I

    • Chlororespiration pathways

    • Maintaining redox balance under various environmental conditions

    • Protection against oxidative stress

  • The subunit 4L specifically contributes to the structural integrity and proper functioning of the NDH complex in the thylakoid membrane.

This protein represents an important component of alternative electron transport pathways that help optimize photosynthetic efficiency under changing environmental conditions .

How does this protein contribute to photosynthesis in Lemna minor?

In Lemna minor, which is studied as a model for photosynthesis research, this protein plays several key roles:

  • It participates in cyclic electron transport around photosystem I, which generates ATP without producing NADPH, helping to balance the ATP/NADPH ratio for optimal photosynthetic metabolism .

  • Studies of photosynthesis in Lemna minor typically examine parameters such as chlorophyll fluorescence, which can indirectly measure the activity of alternative electron transport pathways involving this protein .

  • When growing Lemna minor for photosynthesis studies, researchers avoid adding external carbon sources to assess the true photosynthetic potential, indicating the importance of native electron transport components like this protein .

The protein's integration into the NDH complex allows it to contribute to photoprotection mechanisms that are particularly important under stress conditions or fluctuating light environments.

What purification strategies are most effective for this membrane protein?

Purifying membrane proteins presents unique challenges due to their hydrophobicity. For this specific protein, the following purification approach is recommended:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag as the primary purification step .

  • Purity Assessment: SDS-PAGE analysis to confirm protein purity (reported as >90% for commercially available preparations) .

  • Detergent Considerations: Since this is a membrane protein, appropriate detergents must be included during purification to maintain solubility while preserving native structure.

  • Buffer Optimization: Tris/PBS-based buffers with stabilizing agents (6% trehalose) at pH 8.0 have been shown to maintain protein stability .

When designing purification protocols, researchers should consider the challenges of membrane protein purification, including the need to balance detergent concentration with protein stability and the potential for aggregation during concentration steps.

What analytical methods are most suitable for studying enzyme kinetics?

When studying the enzyme kinetics of NAD(P)H-quinone oxidoreductases, researchers typically employ several complementary approaches:

  • Spectrophotometric Assays: Monitoring the oxidation of NAD(P)H at 340 nm or the reduction of quinone substrates through changes in absorbance.

  • Substrate Selection: Duroquinone (2,3,5,6-tetramethyl-p-benzoquinone) has been established as a suitable substrate for NAD(P)H:quinone oxidoreductase activity assays .

  • Ping-Pong Mechanism Analysis: These enzymes typically follow a ping-pong mechanism where NAD(P)H first reduces the enzyme-bound FAD, then NAD(P)+ leaves the active site before the quinone substrate binds and becomes reduced .

  • Structural Considerations: The enzyme exhibits "exquisite control of access to the catalytic site" with specific residues (such as tyrosine-128 and the loop spanning residues 232-236 in homologous enzymes) playing key roles in substrate binding and product release .

ParameterTypical Measurement MethodExpected Range
K<sub>m</sub> for NAD(P)HSpectrophotometric assayLow micromolar range
K<sub>m</sub> for quinone substratesSpectrophotometric assayVariable depending on substrate
k<sub>cat</sub>Initial rate measurementsSpecies and condition-dependent
pH optimumActivity measurements at varying pHTypically 7.0-8.0
Temperature optimumActivity measurements at varying temperatures25-37°C depending on source

How can metabolomic approaches be integrated with functional studies of this protein?

Metabolomic analysis can provide valuable insights when studying the functional impact of NAD(P)H-quinone oxidoreductase in Lemna minor:

  • Untargeted Metabolomics: Using platforms like FOR-IDENT and PLANT-IDENT databases can help identify metabolites affected by alterations in electron transport pathways involving this protein .

  • Extraction Methods: For comprehensive metabolite coverage, researchers should consider multiple extraction methods. Studies have shown that using three different solvent systems (100% MeOH, 50% MeOH, and 100% H₂O) provides optimal coverage of the Lemna minor metabolome .

  • Analytical Platforms: RPLC-HILIC-ESI-TOF-MS and RPLC-HILIC-ESI-QTOF-MS/MS systems have been successfully employed for untargeted analysis of Lemna minor metabolites, with the latter showing higher sensitivity for detecting features .

  • Data Analysis: OPLS-DA (Orthogonal Partial Least Squares Discriminant Analysis) can be used to identify metabolites that distinguish between different experimental conditions, such as wild-type versus mutant lines affecting this protein .

By integrating metabolomics with functional studies, researchers can connect alterations in electron transport pathways to broader metabolic consequences, providing a systems-level understanding of this protein's role.

What structural insights can be gained from comparative analysis with homologs from other species?

While the three-dimensional structure of Lemna minor NAD(P)H-quinone oxidoreductase subunit 4L has not been directly determined, valuable insights can be gained through comparative analysis with homologous proteins:

  • Mammalian Homologs: Structures of human and mouse NAD(P)H:quinone oxidoreductases have been determined at high resolution (1.7Å and 2.8Å respectively), revealing key aspects of the catalytic mechanism .

  • Substrate Binding: In the human QR1-duroquinone complex, one ring carbon is positioned closer to the flavin N5, suggesting a direct hydride transfer mechanism that may be conserved across species .

  • Conformational Changes: Structures reveal that tyrosine-128 and a loop spanning residues 232-236 close the binding site after substrate or cofactor binding, controlling access to the catalytic site in a way that enables the ping-pong reaction mechanism .

  • Species Differences: Subtle structural variations explain functional differences between species. For example, rat, mouse, and human enzymes show different specificities for electron acceptor substrates, with rat enzyme being approximately twice as efficient at reducing menadione compared to human and mouse enzymes .

These structural insights provide a framework for understanding the function of the Lemna minor protein and can guide site-directed mutagenesis studies to probe specific aspects of its mechanism.

What are the challenges and strategies for studying protein-protein interactions within the NDH complex?

Investigating protein-protein interactions for membrane-embedded components of multi-subunit complexes presents several challenges:

  • Membrane Environment: Traditional protein-protein interaction methods may disrupt the native membrane environment necessary for proper complex assembly.

  • Complex Stability: The NDH complex may be destabilized when removed from the thylakoid membrane or when individual components are studied in isolation.

  • Technical Approaches: Several specialized techniques can help overcome these challenges:

    • Chemical cross-linking coupled with mass spectrometry

    • Blue-native PAGE for intact complex analysis

    • Co-immunoprecipitation with detergent-solubilized membranes

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

    • Split-GFP complementation assays for membrane protein interactions

  • Reconstitution Systems: Reconstituting the protein into liposomes or nanodiscs can provide a membrane-like environment for interaction studies while maintaining accessibility to analytical techniques.

How might this protein contribute to Lemna minor's potential as a sustainable food source?

Recent research has explored Lemna minor as a sustainable vegetable crop, with implications for the function of its photosynthetic machinery:

What potential applications exist for genetically modified variants of this protein?

Engineering the NAD(P)H-quinone oxidoreductase protein could yield several biotechnological applications:

  • Enhanced Stress Tolerance: Modified variants could improve electron transport efficiency under stress conditions, enhancing Lemna minor's resilience to environmental challenges.

  • Increased Biomass Production: Optimizing electron transport pathways could improve photosynthetic efficiency and carbon fixation, leading to faster growth and higher biomass yields.

  • Bioremediative Applications: Engineered variants might enhance Lemna minor's capacity to detoxify specific environmental contaminants through altered quinone reduction pathways.

  • Biofortification: Modifications that influence metabolic flux through pathways connected to this protein could potentially enhance the nutritional value of Lemna minor for human consumption .

  • Bioreactor Optimization: Understanding and engineering this protein could support the development of Lemna minor as a platform for producing recombinant proteins or high-value metabolites.

What emerging technologies might advance our understanding of this protein's function?

Several cutting-edge technologies show promise for deepening our understanding of this protein:

  • Cryo-Electron Microscopy: This technique could reveal the structure of the entire NDH complex, including the precise position and interactions of the subunit 4L protein within the native complex.

  • In vivo Fluorescence Techniques: Advanced fluorescence imaging methods could track the dynamics and localization of this protein during various physiological conditions.

  • Genome Editing: CRISPR-Cas9 technology could enable precise modification of the native gene to study the effects of specific mutations on photosynthetic efficiency and plant growth.

  • Synthetic Biology Approaches: Minimal reconstructed systems could help define the essential components and interactions required for proper function.

  • Metabolic Flux Analysis: Isotope labeling combined with metabolomics could trace how alterations in this protein affect carbon flow through photosynthetic and respiratory pathways.

What knowledge gaps remain in our understanding of chloroplastic NAD(P)H-quinone oxidoreductases?

Despite significant advances, several important questions remain unresolved:

  • Regulatory Mechanisms: How is the activity of this protein regulated in response to changing environmental conditions and metabolic demands?

  • Evolution: How have chloroplastic NAD(P)H-quinone oxidoreductases evolved compared to their bacterial ancestors and mammalian counterparts?

  • Substrate Specificity: What determines the specificity for different quinone substrates, and how might this vary across plant species?

  • Integration with Other Pathways: How does this protein's function coordinate with other electron transport pathways, including linear electron flow and cyclic electron flow around PSI?

  • Species Variations: How do structural and functional differences in this protein contribute to the unique photosynthetic characteristics of different plant species?

Addressing these questions will require integrative approaches combining structural biology, biochemistry, genetics, and systems biology to fully elucidate the role of this important chloroplastic protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.