Recombinant Lemna minor NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction and Background

NAD(P)H-quinone oxidoreductases constitute a family of enzymes that catalyze the two-electron reduction of quinones and a wide range of other organic compounds. Their physiological roles include reducing free radical load in cells and detoxifying xenobiotics . The NAD(P)H-quinone oxidoreductase subunit 6 from Lemna minor (Common duckweed) is a chloroplastic protein that functions within the photosynthetic electron transport chain.

Lemna minor, commonly known as duckweed, is an aquatic plant with significant ecological importance. As a fast-growing aquatic macrophyte, it has gained attention for potential applications in phytoremediation, biofuel production, and as a model organism for studying plant biology. The NAD(P)H-quinone oxidoreductase subunit 6 in this organism is encoded by the ndhG gene and is localized in the chloroplast, where it participates in cyclic electron flow around photosystem I .

Enzymatic Classification and Nomenclature

The Recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 belongs to the oxidoreductase class of enzymes with the Enzyme Commission (EC) number 1.6.5.- . This classification designates enzymes that catalyze redox reactions using NAD(P)H as an electron donor and quinones as electron acceptors. Alternative names for this enzyme include:

  • NAD(P)H dehydrogenase subunit 6

  • NADH-plastoquinone oxidoreductase subunit 6

This nomenclature reflects the protein's functional role in transferring electrons from NADH or NADPH to plastoquinone within the chloroplast electron transport chain.

Molecular Structure and Properties

The Recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 is a full-length protein consisting of 177 amino acid residues . Understanding the structural properties of this protein provides insights into its functional mechanisms and interactions within the chloroplastic environment.

Quaternary Structure

While the specific quaternary structure of the Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 has not been directly reported in the provided research, NAD(P)H quinone oxidoreductases typically function as homodimers with two active sites formed from residues contributed by both polypeptide chains . Each active site comprises elements from both subunits, creating a functional unit at the interface between the monomers.

Cofactor Requirements

NAD(P)H quinone oxidoreductases require a tightly bound FAD cofactor for catalytic activity. This cofactor plays a crucial role in the electron transfer mechanism, accepting electrons from NAD(P)H and transferring them to the quinone substrate . The reaction proceeds via a substituted enzyme (ping-pong) mechanism, where the FAD cofactor is reduced by NAD(P)H in the first step of the reaction.

Biochemical Function and Mechanism

The primary biochemical function of NAD(P)H-quinone oxidoreductase subunit 6 involves electron transfer processes within the chloroplast. Understanding the catalytic mechanism provides insights into the protein's role in photosynthetic energy metabolism.

Catalytic Mechanism

NAD(P)H quinone oxidoreductases catalyze the two-electron reduction of quinones, thereby avoiding the production of reactive semiquinone intermediates that could generate harmful reactive oxygen species . The catalytic mechanism follows a substituted enzyme (ping-pong) pattern:

  1. NAD(P)H binds to the enzyme and transfers electrons to the FAD cofactor

  2. The reduced FAD then transfers these electrons to the quinone substrate

  3. The reduced quinone (quinol) is released

  4. The enzyme returns to its original state, ready for another catalytic cycle

This mechanism allows for efficient electron transfer while minimizing the production of potentially harmful intermediates.

Substrate Specificity

NAD(P)H quinone oxidoreductases exhibit remarkable substrate versatility, catalyzing the reduction of various quinones and other organic compounds . Different enzymes within this family display distinct substrate specificity profiles. Based on studies of related enzymes, these preferences may be determined by the size and composition of the active site pocket .

Some NAD(P)H quinone oxidoreductases show preferential activity toward benzoquinones, while others more efficiently reduce naphthoquinones . This substrate specificity allows organisms to detoxify a wide range of quinone compounds encountered in their environment.

Role in Photosynthetic Electron Transport

In chloroplasts, the NAD(P)H-quinone oxidoreductase complex (NDH complex) participates in cyclic electron flow around photosystem I. This process generates additional ATP without producing NADPH, allowing the plant to adjust the ATP/NADPH ratio according to metabolic demands. The subunit 6 (encoded by ndhG) is an integral component of this complex, contributing to its assembly and function in the thylakoid membrane.

Recombinant Production and Characterization

The recombinant production of Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 enables detailed biochemical and structural studies of this protein. Various expression systems and purification strategies have been developed to obtain functionally active protein for research and commercial applications.

Expression Systems and Purification

The recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 is typically produced using bacterial or eukaryotic expression systems. After expression, the protein undergoes a series of purification steps to obtain a homogeneous preparation suitable for biochemical studies or commercial applications .

Commercial preparations of this recombinant protein are available as research tools for studying chloroplast electron transport and related processes. These preparations typically contain the full-length protein (177 amino acids) with appropriate tags for detection and purification .

Comparison with Related Proteins

Understanding the evolutionary relationships and functional similarities between NAD(P)H-quinone oxidoreductase subunit 6 and related proteins provides valuable insights into its biological significance and potential applications.

Relationship to Azoreductases

Recent research has revealed that azoreductases and NAD(P)H quinone oxidoreductases belong to the same enzyme superfamily . Despite their historical classification as separate enzyme groups, they share similar reaction mechanisms and structural features. Both enzyme families catalyze the reduction of their respective substrates via a substituted enzyme mechanism involving a flavin cofactor.

The ubiquitous and diverse nature of these enzymes, along with their broad substrate specificity, suggests they play important roles in cellular survival under adverse conditions . This relationship expands our understanding of the evolutionary history and functional versatility of NAD(P)H-quinone oxidoreductase subunit 6.

The biological significance of NAD(P)H-quinone oxidoreductase subunit 6 extends beyond its role in photosynthetic electron transport. Understanding its various functions provides insights into potential applications in biotechnology and environmental remediation.

Role in Oxidative Stress Response

NAD(P)H quinone oxidoreductases play crucial roles in protecting cells against oxidative stress by preventing the formation of reactive oxygen species (ROS) . By catalyzing the two-electron reduction of quinones, these enzymes bypass the formation of semiquinone radicals that could otherwise generate superoxide and other harmful ROS.

In plants, the chloroplastic NAD(P)H-quinone oxidoreductase complex contributes to cellular redox homeostasis and protection against environmental stressors. This protective function is particularly important under conditions of high light intensity, drought, or other stresses that can increase ROS production in chloroplasts.

Biotechnological Applications

The recombinant production of Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 facilitates various biotechnological applications:

  1. Research tools for studying chloroplast electron transport

  2. Development of biosensors for detecting quinone compounds

  3. Enzyme-based bioremediation systems for detoxifying quinone pollutants

  4. Potential targets for improving plant stress tolerance through genetic engineering

These applications leverage the enzyme's natural capacity for quinone reduction and its role in cellular protection against oxidative stress.

Future Research Directions

Despite advances in understanding NAD(P)H-quinone oxidoreductase subunit 6, several aspects of its structure, function, and regulation remain to be fully elucidated.

Structure-Function Relationships

Future research could focus on determining the high-resolution structure of Lemna minor NAD(P)H-quinone oxidoreductase subunit 6 and its integration within the larger NDH complex. This structural information would provide valuable insights into the molecular mechanisms underlying its function in electron transport and could guide the rational design of modified enzymes with enhanced catalytic properties.

Role in Plant Adaptation

Further investigation into how NAD(P)H-quinone oxidoreductase subunit 6 contributes to plant adaptation to environmental stresses could reveal new strategies for improving crop resilience. Understanding the regulation of its expression and activity under different environmental conditions might identify key factors that could be targeted for enhancing plant performance in challenging environments.

Potential for Enzyme Engineering

The detailed understanding of the protein's structure and catalytic mechanism opens possibilities for enzyme engineering to develop variants with altered substrate specificity, improved catalytic efficiency, or enhanced stability. Such engineered enzymes could find applications in biocatalysis, bioremediation, or biosensor development.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Lemna minor (Common duckweed)
Target Names
ndhG
Target Protein Sequence
MDLTGPIHDILVVFLGLVLILGGLGVVLFTNPIYSAFSLGLVLICVSLFYILLNSYFVAA AQLLIYVGAINVLILFAVMFMKGSEYSNDLNLWTVGDGVTSLVCTSILFLLISTISDTSW YGIIWTTKANHIIEQDLISNVQQIGIHLSTDFFLPFELISIILLVALIGAISMARQN
Uniprot No.

Target Background

Function
NDH (NAD(P)H dehydrogenase) facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. NDH couples the redox reaction with proton translocation, effectively conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 6 in Lemna minor and what is its function?

NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG) is a key component of the photosynthetic electron transport chain in Lemna minor (Common duckweed). This protein functions as part of the NDH complex that mediates electron transfer from NAD(P)H to plastoquinone in chloroplasts. The protein has the UniProt accession number A9L9F0 and is classified under EC 1.6.5.- . It is involved in cyclic electron flow around photosystem I and chlororespiration, contributing to ATP synthesis under various environmental conditions. The protein is also known by alternative names including NAD(P)H dehydrogenase subunit 6 and NADH-plastoquinone oxidoreductase subunit 6 .

Similar to other NAD(P)H quinone oxidoreductases, such as NDC1 (NAD(P)H dehydrogenase C1), this enzyme likely plays crucial roles in energy metabolism and prenylquinone metabolism within chloroplasts . Research on related enzymes suggests it may be involved in maintaining the redox state of the plastoquinone pool, which is essential for proper photosynthetic function.

Why is Lemna minor used as a model organism for studying chloroplastic proteins?

Lemna minor has emerged as an excellent model system for studying chloroplastic proteins and plant physiology for several important reasons:

  • Rapid clonal growth: Lemna minor has an exceptionally fast doubling time of approximately 2 days, resulting in genetically uniform populations that facilitate reproducible experimental results .

  • Laboratory convenience: Due to its small size and ease of manipulation, the duckweed is widely used in laboratory conditions for both physiological and ecotoxicological studies .

  • Genomic resources: Recent developments in sequencing technology have made genomic and transcriptomic resources available for Lemna minor, supporting genetic and epigenetic studies .

  • Simple cultivation: The plant can be aseptically cultured in defined media under controlled conditions, allowing for precise manipulation of environmental variables .

  • Environmental applications: Lemna minor has demonstrated potential for phytoremediation applications, being able to accumulate heavy metals such as copper and detoxify organic pollutants like herbicides .

  • Protein expression platform: Studies have shown that Lemna minor can be successfully transformed to express recombinant proteins, as demonstrated with human plasminogen , suggesting it could potentially be used to produce other recombinant proteins including chloroplastic enzymes.

These attributes make Lemna minor an ideal system for studying chloroplastic proteins like NAD(P)H-quinone oxidoreductase subunit 6, allowing researchers to investigate both fundamental aspects of photosynthesis and applied questions relating to plant stress responses and adaptation.

What protocols are recommended for storage and handling of recombinant NAD(P)H-quinone oxidoreductase subunit 6?

For optimal preservation of structural integrity and enzymatic activity, recombinant NAD(P)H-quinone oxidoreductase subunit 6 should be stored according to the following recommendations:

  • Storage conditions:

    • Store at -20°C for routine use

    • For extended storage, conserve at -20°C or -80°C

    • Store in Tris-based buffer containing 50% glycerol, optimized for protein stability

  • Handling guidelines:

    • Avoid repeated freezing and thawing as this can lead to protein denaturation and activity loss

    • For working stocks, prepare small aliquots and store at 4°C for up to one week

    • Thaw frozen stocks on ice to minimize thermal stress on the protein structure

  • Quality control considerations:

    • Periodically verify protein integrity through SDS-PAGE analysis

    • Monitor enzymatic activity using appropriate substrate assays, such as those measuring quinone reduction

    • Ensure buffer pH remains stable during storage periods

These storage and handling protocols are designed to maintain the native conformation and catalytic function of the recombinant protein, thereby ensuring reliable experimental results.

What methodologies can assess the enzymatic activity of NAD(P)H-quinone oxidoreductase subunit 6?

Evaluating the enzymatic activity of NAD(P)H-quinone oxidoreductase subunit 6 requires specialized methodologies that account for its membrane-associated nature and specific electron transfer function. The following approaches can be employed:

  • Spectrophotometric assays:

    • Monitoring NAD(P)H oxidation at 340 nm in the presence of quinone acceptors

    • Using decyl-plastoquinone as a substrate, similar to studies with related quinone oxidoreductases

    • Employing plastoquinone analogs such as decyl-PQ as demonstrated effective with NDC1

  • Plastoglobule-based activity assays:

    • Purified plastoglobules can serve as quinone-containing substrates for activity measurements

    • This approach allows assessment of electron transfer to native quinone pools

    • Reaction conditions typically include NADPH as the electron donor

  • In vivo redox state analysis:

    • Analysis of the plastoquinone pool redox state using rapid extraction techniques

    • Comparing wild-type and mutant/transgenic lines to assess functional impacts

    • HPLC-based quantification of reduced and oxidized plastoquinone species

  • Reconstitution experiments:

    • Incorporation of purified recombinant protein into liposomes containing plastoquinone

    • Measurement of quinone reduction in this reconstituted system

    • Assessment of cofactor requirements and inhibitor sensitivity

How does environmental stress affect the expression and activity of NAD(P)H-quinone oxidoreductase in Lemna minor?

Environmental stressors significantly modulate the expression and activity of chloroplastic proteins including NAD(P)H-quinone oxidoreductases in Lemna minor. Research reveals complex adaptive responses that may involve both genetic and epigenetic mechanisms:

  • Temperature stress responses:

    • High temperature exposure induces changes in DNA methylation patterns in Lemna minor, which may affect gene expression of chloroplast proteins

    • These epigenetic changes can persist transgenerationally in clonal lineages, potentially causing long-term modulation of stress responses

    • Temperature fluctuations may alter the electron transport requirements, leading to adjustments in NAD(P)H-quinone oxidoreductase activity

  • Oxidative stress responses:

    • Exposure to copper and herbicides triggers accumulation of reactive oxygen species (ROS) including O₂⁻ and H₂O₂ in Lemna minor

    • This oxidative stress activates antioxidative enzyme systems which may interact with chloroplastic electron transport

    • NAD(P)H-quinone oxidoreductases likely play roles in maintaining redox homeostasis during such stress conditions

  • Comparative stress response data:

StressorPrimary ResponseSecondary Effects on Electron TransportRecovery Mechanism
Copper (50-100 μg/L)Oxidative burst, ROS accumulationAltered redox state, potential upregulation of alternative electron pathwaysAntioxidative enzyme activation
Herbicide exposureLong-lasting oxidative responsePossible inhibition of photosynthetic electron transportDetoxification via glutathione conjugation
High temperature (30°C)DNA methylation changesModified gene expression affecting NDH complex componentsTransgenerational epigenetic adaptation
  • Molecular adaptation mechanisms:

    • Stress-induced epigenetic modifications may alter the expression of NAD(P)H-quinone oxidoreductase genes

    • These modifications appear more stable in asexually reproducing plants like Lemna minor compared to sexually reproducing species

    • The absence of germline resetting in clonal reproduction allows for potential long-term inheritance of adaptive epigenetic marks

Understanding these stress response mechanisms is crucial for applications in environmental monitoring, phytoremediation, and fundamental studies of plant adaptation to changing conditions.

What role does NAD(P)H-quinone oxidoreductase subunit 6 play in plastoquinone reduction in Lemna minor?

The NAD(P)H-quinone oxidoreductase subunit 6 likely contributes to a specialized pathway of non-photochemical plastoquinone (PQ) reduction in Lemna minor, similar to what has been observed with related enzymes:

This specialized role in plastoquinone reduction represents an important component of the plant's photosynthetic machinery and energy metabolism, with implications for adaptation to environmental challenges.

How do epigenetic factors influence ndhG expression in clonal Lemna minor lineages?

Epigenetic regulation appears to play a significant role in the expression of chloroplast-related genes in Lemna minor, including potentially the ndhG gene encoding NAD(P)H-quinone oxidoreductase subunit 6:

  • Temperature-induced DNA methylation:

    • Research demonstrates that exposure to high temperatures (30°C) produces changes in DNA methylation profiles in Lemna minor

    • These methylation changes persist transgenerationally in clonal lineages, suggesting stable epigenetic memory

    • Such modifications likely affect the expression of genes involved in stress responses, including chloroplast proteins

  • Clonal reproduction advantages:

    • The asexual reproduction of Lemna minor circumvents germline resetting of epigenetic marks

    • This characteristic makes Lemna particularly conducive to long-term inheritance of epigenetic modifications

    • Genetically identical lineages can develop distinct epigenetic profiles in response to environmental conditions

  • Potential mechanisms affecting ndhG:

    • Methylation in promoter regions could directly modulate ndhG transcription

    • Altered expression of transcription factors controlling ndhG might result from epigenetic changes

    • Chromatin structure modifications may affect accessibility of the gene to transcriptional machinery

  • Experimental approaches to study epigenetic regulation:

    • DNA methylation screening after exposure to different temperature regimes

    • Comparison of gene expression profiles between lineages with different exposure histories

    • Analysis of histone modifications in regulatory regions of ndhG

    • Use of epigenetic inhibitors to assess the impact on gene expression and phenotype

  • Functional consequences:

    • Epigenetic regulation likely contributes to the plant's ability to adapt to changing environments

    • The transgenerational stability of these modifications provides potential for long-term modulation of stress responses

    • Understanding these mechanisms could inform strategies for improving plant performance under stress conditions

This epigenetic dimension adds significant complexity to our understanding of gene regulation in Lemna minor and offers exciting opportunities for research into adaptation mechanisms in asexually reproducing plants.

What expression systems are optimal for producing recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 6?

Several expression systems can be utilized for the production of recombinant Lemna minor NAD(P)H-quinone oxidoreductase subunit 6, each with distinct advantages and limitations:

  • Lemna-based expression system:

    • Homologous expression in transformed Lemna minor provides native post-translational modifications

    • The successful use of Lemna for producing human plasminogen demonstrates its capacity for recombinant protein expression

    • Growth in controlled media under defined conditions allows for optimization of protein production

    • Extraction protocols would involve tissue homogenization followed by affinity chromatography

  • Bacterial expression systems:

    • E. coli-based expression offers high yield and established protocols

    • Codon optimization may be necessary for efficient expression

    • Fusion tags (His, GST, MBP) can facilitate purification and potentially improve solubility

    • Membrane protein expression may require specialized strains or periplasmic targeting

  • Comparative expression system efficiency:

Expression SystemAdvantagesChallengesPurification Strategy
Lemna minorNative folding, post-translational modificationsLower yield, longer production timeAffinity chromatography using substrate analogs
E. coliHigh yield, rapid productionPotential misfolding, lack of modificationsIMAC, ion exchange followed by specialized chromatography
Yeast systemsEukaryotic processing, secretion possibleMedium yield, glycosylation differencesAffinity chromatography, size exclusion
Insect cellsComplex protein handling capabilityHigher cost, specialized equipment neededMulti-step chromatography approaches
  • Purification considerations:

    • Affinity tags should be selected based on compatibility with downstream applications

    • For membrane proteins like NAD(P)H-quinone oxidoreductase subunit 6, detergent screening is crucial for solubilization

    • Substrate affinity chromatography using immobilized quinone analogs may provide specific purification

    • For structural studies, tag removal might be necessary using precision proteases

  • Quality control:

    • Enzymatic activity assays using plastoquinone analogs as substrates

    • Mass spectrometry to confirm protein identity and modifications

    • Circular dichroism to assess secondary structure integrity

    • Size exclusion chromatography to evaluate oligomeric state

The optimal expression system depends on the specific research goals, whether focused on functional studies, structural analysis, or application development. Each approach requires careful optimization of expression conditions and purification protocols to obtain functionally active recombinant protein.

What analytical techniques are suitable for studying the redox properties of NAD(P)H-quinone oxidoreductase subunit 6?

Understanding the redox properties of NAD(P)H-quinone oxidoreductase subunit 6 requires sophisticated analytical approaches that can probe electron transfer processes at multiple levels:

  • Electrochemical methods:

    • Protein film voltammetry to determine redox potentials

    • Cyclic voltammetry using modified electrodes with immobilized enzyme

    • Chronoamperometry to study electron transfer kinetics

    • These approaches provide direct measurement of the protein's redox properties

  • Spectroscopic techniques:

    • UV-visible spectroscopy to monitor NAD(P)H oxidation (at 340 nm) and quinone reduction

    • Fluorescence spectroscopy to track protein conformational changes during catalysis

    • EPR spectroscopy to characterize transient radical species formed during electron transfer

    • Resonance Raman spectroscopy to probe cofactor interactions

  • Advanced redox state analysis:

    • HPLC-based quantification of oxidized and reduced plastoquinone species

    • In vivo monitoring of plastoquinone pool redox state under different conditions

    • Comparison between wild-type and experimental systems to assess functional impact

  • Experimental setup for redox measurements:

  • Molecular insights:

    • Site-directed mutagenesis of key residues predicted to be involved in electron transfer

    • Structure-function analysis correlating redox properties with protein structural elements

    • Comparison with homologous proteins to identify conserved redox mechanisms

These analytical approaches collectively provide a comprehensive understanding of the electron transfer processes catalyzed by NAD(P)H-quinone oxidoreductase subunit 6, illuminating both its fundamental biochemical properties and physiological roles in photosynthetic electron transport.

What methods are most effective for studying in vivo function of NAD(P)H-quinone oxidoreductase subunit 6?

Investigating the in vivo function of NAD(P)H-quinone oxidoreductase subunit 6 requires integrative approaches that connect molecular activity to physiological outcomes:

ApproachParametersControlsExpected Outcomes
Gene editingComplete loss of functionComplemented lines, wild-typeAltered electron transport, potential growth phenotypes
Chlorophyll fluorescencePSII yield, NPQ, electron transport rateDark-adapted measurements, inhibitor treatmentsChanges in alternative electron flow pathways
Plastoquinone analysisReduced/oxidized PQ ratioMeasurements under varying light conditionsAltered redox state compared to wild-type
Stress experimentsGrowth, ROS levels, enzyme activitiesWild-type under same conditionsDifferential sensitivity to specific stressors

These multifaceted approaches provide complementary perspectives on the in vivo function of NAD(P)H-quinone oxidoreductase subunit 6, linking its biochemical activities to physiological roles and adaptive responses in Lemna minor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.