Recombinant Lemna minor Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Relevance

The recombinant Lemna minor Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered version of the native CP47 protein, a core antenna subunit of Photosystem II (PSII) in chloroplasts. Native CP47 binds chlorophyll a and facilitates light harvesting, electron transfer, and oxygen evolution in the photosynthetic process . The recombinant form is typically expressed in heterologous systems (e.g., E. coli) to study its structure, function, or biotechnological applications.

Key Features:

AttributeDetails
GenepsbB (encodes CP47)
Protein Length508 amino acids (full-length)
Molecular Weight~55–56 kDa (predicted from nucleotide sequence)
Expression HostE. coli (His-tagged for purification)
FunctionBinds chlorophyll a, stabilizes PSII core, participates in electron transfer

Functional Role in PSII:

  1. Light Harvesting: Channels excitation energy to the reaction center .

  2. PSII Assembly: Recruitment of OEE proteins (e.g., PsbO, PsbP, PsbQ) depends on CP47’s proper integration .

  3. Oxygen Evolution: Stabilizes the PSII core complex, enabling water oxidation .

Production Workflow:

  1. Cloning: psbB gene amplified from Lemna minor genomic DNA.

  2. Codon Optimization: Adjusted for E. coli expression (as seen in Wolffia arrhiza) .

  3. Expression: Transformed into E. coli, induced for protein synthesis.

  4. Purification: His-tag affinity chromatography .

Proposed Applications:

ApplicationPurpose
Structural BiologyCrystallization for X-ray diffraction studies of chlorophyll binding .
BiotechnologyEngineering PSII for biofuels or artificial photosynthesis .
Diagnostic ToolsELISA kits for detecting psbB in plant extracts (hypothetical) .

Amino Acid Sequence and Domains

The recombinant Lemna minor CP47 (psbB) spans 508 residues, with transmembrane domains critical for chlorophyll binding and PSII integration.

Amino Acid Sequence (Partial):

RegionSequence
N-TerminalMGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM
Core Binding RegionFVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL
C-Terminal...ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA

Full sequence available in .

Challenges and Research Gaps

  1. Folding Efficiency: Proper chlorophyll binding requires correct folding, which may be compromised in E. coli .

  2. Lack of Native Studies: No peer-reviewed studies specifically on Lemna minor’s psbB; inferences drawn from homologs .

  3. Stability Issues: Recombinant CP47 may require chaperones (e.g., PAM68, FPB1) for proper assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Lemna minor (Common duckweed)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VSPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRISAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAIGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Photosystem II CP47 chlorophyll apoprotein in Lemna minor?

The Photosystem II CP47 chlorophyll apoprotein (psbB) in Lemna minor functions as a core antenna protein that collects and transfers light energy to the reaction center of Photosystem II. Structurally, it is similar to other plant CP47 proteins, containing multiple membrane-spanning domains that bind chlorophyll molecules. The protein plays a crucial role in the primary photosynthetic processes, particularly in the electron transport chain of PSII. CP47 is encoded by the psbB gene, typically located in the plastid genome, and forms part of the core complex of PSII along with CP43, D1, and D2 proteins .

When studying this protein's structure-function relationship, researchers should note that CP47 contains domains that coordinate chlorophyll molecules essential for light harvesting. Unlike the CP43 module, research indicates that CP47 does not form standalone modules during PSII repair processes but remains associated with other core proteins .

What are the most effective expression systems for producing recombinant Lemna minor CP47?

Several expression systems can be used for producing recombinant Lemna minor CP47 protein, each with distinct advantages depending on research goals:

For methodology selection, researchers should consider:

  • Required protein yield and purity

  • Importance of post-translational modifications

  • Available laboratory infrastructure

  • Downstream applications

What purification protocols yield the highest purity of recombinant CP47 protein while maintaining functional integrity?

Purification of functionally active CP47 protein requires careful consideration of its membrane-bound nature. Based on similar protein work, the following protocol yields high purity while preserving functional integrity:

  • Affinity Chromatography: For His-tagged recombinant CP47, use nickel affinity chromatography with a step gradient of imidazole (20-300 mM) in the presence of mild detergents (0.03-0.1% n-dodecyl β-D-maltoside) to maintain protein solubility .

  • Buffer Composition: Utilize Tris/PBS-based buffers (pH 8.0) containing glycerol (5-50%) as a stabilizer to prevent protein aggregation and maintain functional conformation .

  • Storage Conditions:

    • Short-term: Store at 4°C for up to one week

    • Long-term: Store at -20°C/-80°C in aliquots with 50% glycerol as a cryoprotectant

    • Avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • Reconstitution Protocol: When working with lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL before adding glycerol for storage .

For quality control, researchers should verify protein purity (>90%) using SDS-PAGE and confirm functional integrity through chlorophyll binding assays or electron transport measurements.

How can researchers assess the functional integrity of recombinant CP47 protein in vitro?

Assessing the functional integrity of recombinant CP47 protein requires multiple complementary approaches:

  • Chlorophyll Binding Assay: Measure chlorophyll binding capacity using spectrofluorometric methods. Functional CP47 should bind chlorophyll molecules with characteristic absorption and fluorescence emission spectra.

  • Electron Transport Measurement: Utilize artificial electron acceptors (such as DCPIP) to measure the electron transport capability. Hill reaction activity in isolated chloroplasts provides a quantitative measure of photosynthetic efficiency .

  • Fluorescence Analysis: Measure chlorophyll fluorescence parameters including F₀ (minimal fluorescence), Fᵥ/Fₘ (maximum quantum yield), ΦII (effective quantum yield), and NPQ (non-photochemical quenching) using a PAM fluorometer. These parameters provide insights into the functional status of PSII and its components .

  • Protein-Protein Interaction Assays: Perform co-immunoprecipitation or pull-down assays to verify interaction with known partner proteins such as D1, D2, and CP43.

For comprehensive assessment, researchers should compare results with native protein controls using the following acceptance criteria:

ParameterAcceptance RangeInterpretation
Chlorophyll binding>85% of native controlProper protein folding
Electron transport rate>75% of native controlFunctional integrity
Fᵥ/Fₘ>0.7Efficient energy transfer
Protein-protein interactionDetectable binding to D1/D2Correct tertiary structure

What are the differences in CP47 function between isolated protein and intact photosynthetic systems?

Understanding the functional differences between isolated CP47 protein and its behavior in intact photosynthetic systems is crucial for accurate data interpretation:

  • Energy Transfer Efficiency: Isolated CP47 shows reduced energy transfer efficiency compared to intact systems, where precise spatial orientation with other PSII components optimizes energy flow. Research indicates that isolated CP47 lacks the coordinated interaction with the PSII reaction center .

  • Structural Stability: The CP47 module appears to be less stable when isolated compared to its integration within the PSII supercomplex. Unlike CP43, which can function as a separate module during PSII repair, CP47 does not typically form a standalone functional unit .

  • Response to Environmental Stressors: In intact systems, CP47 function is modulated by various environmental factors. For example, studies in Lemna minor exposed to pharmaceutical compounds (like Naproxen) show that the efficiency of primary photosynthetic processes, including those involving CP47, can be affected by up to 10%, particularly impacting photosystem II function and electron transport .

  • Regulatory Interactions: In intact systems, CP47 function is regulated through interactions with small subunits and regulatory proteins absent in isolated preparations.

For experimental design, researchers should consider these differences when extrapolating results from isolated protein studies to whole-plant physiology.

How can Lemna minor CP47 be genetically modified to enhance photosynthetic efficiency?

Genetic modification of Lemna minor CP47 to enhance photosynthetic efficiency represents an advanced research direction with several promising approaches:

When designing genetic modifications, researchers should target regions that:

  • Are not highly conserved across species (less likely to disrupt essential functions)

  • Are involved in efficiency-limiting steps of energy transfer

  • Interface with other PSII components for improved system integration

What role does CP47 play in the photosystem II repair cycle, and how can this be experimentally investigated?

CP47 plays a crucial role in the photosystem II repair cycle, which is essential for maintaining photosynthetic function under various stress conditions:

  • Retention During Repair: Unlike CP43, which detaches during D1 protein replacement, CP47 tends to remain associated with the D2 protein during initial repair stages. Only when D2 is also damaged does CP47 become unassembled .

  • Reassembly Scaffold: CP47 likely serves as a scaffold during PSII reassembly, providing a structural foundation for incorporating newly synthesized D1 and other components.

To experimentally investigate CP47's role in the repair cycle, researchers can employ several methodologies:

  • Pulse-Chase Experiments: Use radiolabeled amino acids to track the fate of CP47 during PSII damage and repair cycles. This approach allows temporal resolution of protein dynamics.

  • Site-Directed Mutagenesis: Create specific mutations in regions of CP47 thought to be important for repair cycle interactions, then measure repair efficiency under photodamaging conditions.

  • Protein-Protein Interaction Mapping: Employ techniques such as chemical cross-linking followed by mass spectrometry to identify CP47 interaction partners during different stages of the repair cycle.

  • Fluorescence Recovery After Photobleaching (FRAP): This technique can provide insights into the mobility and exchange rates of CP47 during repair processes.

  • Comparative Analysis Across Stress Conditions: Assess repair cycle dynamics under various stressors, such as pharmaceutical compounds that have been shown to affect photosynthetic parameters in Lemna minor .

A comprehensive experimental design should include both in vitro and in vivo approaches, with careful attention to physiologically relevant conditions.

How does CP47 structure and function in Lemna minor compare to cyanobacterial CP47 proteins?

Comparing Lemna minor CP47 with cyanobacterial counterparts reveals important evolutionary insights and functional conservation:

  • Structural Conservation: The core structure of CP47 is highly conserved between Lemna minor and cyanobacteria, reflecting the evolutionary conservation of PSII architecture since the endosymbiotic event that gave rise to chloroplasts. Both contain multiple transmembrane domains that coordinate chlorophyll molecules.

  • Genomic Context: In Lemna minor, as in other angiosperms, the psbB gene is located in the plastid genome, similar to its position in the cyanobacterial genome. The gene arrangement around psbB can vary between species due to genomic rearrangements over evolutionary time .

  • Functional Adaptation: While core functions remain conserved, Lemna minor CP47 likely contains adaptations for functioning in a eukaryotic cellular environment and for optimization to specific light environments.

  • IR Expansion Effects: In some plant species, genomic rearrangements have led to the incorporation of photosystem genes, including those encoding CP47 components, into the inverted repeat (IR) regions of the plastid genome . While specific data for Lemna minor is not provided, such variations could affect gene dosage and expression levels.

For comparative studies, researchers should include sequence alignment, structural modeling, and functional assays comparing photosynthetic efficiency parameters across evolutionary diverse organisms.

What genomic and proteomic approaches are most effective for studying CP47 evolution in aquatic plants?

Studying CP47 evolution in aquatic plants like Lemna minor requires integrated genomic and proteomic approaches:

  • Whole Plastome Sequencing and Analysis: This approach reveals the genomic context of psbB and evolutionary rearrangements. Research has shown that the plastid genome organization, including IR boundaries that may affect photosystem genes, varies significantly among plant lineages .

  • Comparative Transcriptomics: RNA-Seq analysis across diverse aquatic plant species can reveal differential expression patterns and alternative splicing of psbB transcripts.

  • Phylogenetic Analysis: Construct phylogenetic trees based on psbB sequences from diverse aquatic plants to identify:

    • Selection pressures on different domains

    • Evolutionary rate variations

    • Lineage-specific adaptations

  • Protein Structure Prediction and Comparison: Employ homology modeling and structural alignment to identify conserved and divergent structural elements across species.

  • Functional Genomics: CRISPR-based approaches to introduce ancestral or alternative CP47 variants can test functional hypotheses about evolutionary adaptations.

  • Proteomic Analysis of Interaction Networks: Mass spectrometry-based approaches can identify species-specific differences in CP47 interaction partners.

For effective implementation, researchers should compile a diverse dataset spanning evolutionary distance, ecological niches, and photosynthetic strategies, with particular attention to aquatic plant adaptations.

What are the common challenges in expressing and purifying functional recombinant CP47, and how can they be addressed?

Researchers face several challenges when working with recombinant CP47 protein:

  • Protein Misfolding and Aggregation:

    • Challenge: As a membrane protein, CP47 tends to aggregate during expression and purification.

    • Solution: Incorporate mild detergents (0.03-0.1% n-dodecyl β-D-maltoside) throughout the purification process and maintain glycerol (5-50%) in storage buffers .

  • Loss of Chlorophyll Association:

    • Challenge: Recombinant CP47 often fails to properly associate with chlorophyll molecules.

    • Solution: Consider co-expression with chlorophyll biosynthesis genes or perform reconstitution with purified chlorophyll under controlled conditions.

  • Low Expression Yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host, test multiple promoters, and consider inducible expression systems. For plant-based expression, target expression levels of 0.4-0.5 μg protein per gram of fresh weight are achievable based on similar recombinant proteins in Lemna minor .

  • Protein Instability:

    • Challenge: Purified CP47 loses activity during storage.

    • Solution: Avoid repeated freeze-thaw cycles, aliquot samples before freezing, and store at -80°C in buffer containing 50% glycerol .

  • Functional Assessment Difficulties:

    • Challenge: Confirming that recombinant CP47 is functionally equivalent to native protein.

    • Solution: Employ multiple complementary assays including chlorophyll binding, fluorescence parameters, and interaction studies with partner proteins.

A systematic optimization approach addressing each challenge sequentially often yields the best results.

How can researchers accurately quantify CP47 accumulation in transgenic Lemna minor plants?

Accurate quantification of CP47 accumulation in transgenic Lemna minor requires robust methodological approaches:

  • Western Blot Analysis: Using specific antibodies against CP47 or attached epitope tags (e.g., His-tag) provides a semi-quantitative measure of protein accumulation. This approach has been successfully used for quantifying recombinant proteins in Lemna minor, with detectable levels of 0.4-0.5 μg protein per gram of fresh weight .

  • ELISA-Based Quantification: Develop sandwich ELISA using anti-CP47 antibodies for more precise quantification, particularly for large sample numbers.

  • Mass Spectrometry:

    • Selected Reaction Monitoring (SRM) using synthetic peptide standards enables absolute quantification

    • Data-Independent Acquisition (DIA) provides relative quantification across multiple samples

  • Fluorescence-Based Methods:

    • If CP47 is fused to a fluorescent protein, confocal microscopy combined with image analysis can provide spatial and quantitative information

    • Fluorescence correlation spectroscopy allows quantification at the single-molecule level

  • Quality Control Considerations:

    • Include appropriate standard curves using purified recombinant protein

    • Account for extraction efficiency variations between samples

    • Consider stability during long-term storage, as studies have shown protein retention in lyophilized transgenic plants even after 1.5 years of storage

For accurate results, researchers should validate at least two independent quantification methods and include appropriate controls for extraction efficiency.

What are the potential applications of engineered Lemna minor CP47 variants in bioenergy research?

Engineered variants of Lemna minor CP47 offer several promising applications in bioenergy research:

For practical implementation, researchers should consider:

  • High-throughput screening methodologies to identify beneficial variants

  • Whole-system effects of CP47 modifications on photosynthetic complexes

  • Scalability of transformation and cultivation systems for bioenergy applications

How does the CP47 protein contribute to photosystem II stability under environmental stress conditions?

CP47 plays a critical role in maintaining photosystem II stability under various environmental stressors:

To experimentally investigate these roles, researchers can:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.