Recombinant Lemna minor Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The Recombinant Lemna minor Photosystem Q(B) protein (UniProt ID: A9L976) is a full-length, His-tagged variant of the PSII D1 protein, a core subunit responsible for water splitting and electron transfer in oxygenic photosynthesis . It is produced recombinantly for experimental applications, retaining functional and structural characteristics of the native protein .

Primary Structure

  • Amino Acid Sequence: 344 residues .

  • Key Domains: Transmembrane helices, plastoquinone-binding sites, and phosphorylation motifs critical for PSII assembly and repair .

PropertyDetail
Molecular Weight~39 kDa (calculated from sequence)
TagHis-tag (position determined during production)
Post-Translational ModificationsPhosphorylation at threonine residues alters SDS-PAGE migration .

Production and Purification

  • Expression System: Recombinant expression in E. coli .

  • Purity: >90% as verified by SDS-PAGE .

ParameterSpecification
Storage BufferTris-based buffer, 50% glycerol
Storage Temperature-20°C/-80°C (long-term); 4°C (working aliquots)
Reconstitution0.1–1.0 mg/mL in deionized water; glycerol addition recommended .

Photosynthetic Activity

  • Electron Transport: Binds plastoquinone at the Q(B) site, facilitating electron transfer from water to plastoquinone .

  • Light Adaptation: Phosphorylation dynamics regulate PSII repair and light-harvesting efficiency. Lemna exhibits a light-induced increase in PSI/PSII antenna size ratio (F735/F686 = 2.4 in dark vs. 3.2 in light) .

Species-Specific Features

  • Phosphorylation Patterns: Lemna PSII core proteins display distinct phosphorylation states compared to Arabidopsis, potentially influencing stress responses .

Evolutionary Conservation

  • Sequence Homology: 85–95% identity with PSII D1 proteins from Prochlorococcus marinus (A8G5N5) and Synechococcus elongatus (P0A447) .

  • Functional Divergence: Despite high sequence conservation, Lemna PSII proteins exhibit unique migration behaviors and modification patterns .

SpeciesProtein LengthKey Difference
Lemna minor344 aaEnhanced phosphorylation variability .
Arabidopsis thaliana344 aaStandard terrestrial plant modification patterns .

Research Applications

  1. Mechanistic Studies: Elucidating PSII dynamics under varying light conditions .

  2. Stress Response Analysis: Investigating herbicide resistance and oxidative damage repair .

  3. Bioengineering: Optimizing photosynthetic efficiency in crops using aquatic plant models .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Lemna minor (Common duckweed)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWVTSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAVIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Photosystem II QB-binding protein in Lemna minor?

The QB-binding protein in Lemna minor is a critical component of Photosystem II (PSII), primarily responsible for binding the mobile plastoquinone electron acceptor (QB). This protein, which is part of the D1 subunit of PSII, facilitates electron transfer from QA to QB during the photosynthetic electron transport chain. In Lemna minor, this protein functions similarly to terrestrial plants but displays unique post-translational modifications that may contribute to the duckweed's efficient photosynthetic performance in aquatic environments . The D1 protein is particularly susceptible to damage during photoinhibition, as evidenced by high-light stress experiments showing decreased Fv/Fm values when this protein becomes damaged .

How does Lemna minor photosynthesis efficiency compare to terrestrial model plants?

Lemna minor exhibits photosynthetic efficiencies comparable or even superior to terrestrial species such as Arabidopsis thaliana under standardized conditions. Research indicates that Lemna displays better quenching efficiencies, suggesting improved light utilization capabilities in this aquatic plant . When measuring chlorophyll fluorescence parameters, Lemna shows a more efficient transfer of electrons from PSII into subsequent processes (either photochemistry or dissipation) . Unlike many vascular plants, Lemna minor does not exhibit the intermediate rise in fluorescence typically resulting from delayed Calvin cycle enzyme activities, indicating a highly efficient or strong electron sink capacity .

What growth conditions optimize photosynthetic protein expression in Lemna minor?

For optimal photosynthetic protein expression in Lemna minor, maintaining appropriate light intensity is crucial. Research on the related species Lemna gibba shows that growth and photosynthetic protein expression are light-dependent, with optimal photosynthetic photon flux density (PPFD) between 100-700 μmol m⁻² s⁻¹ . Under these conditions, the general accumulation of photosynthetic proteins remains relatively constant, suggesting that the stoichiometries of protein complexes within the photosynthetic electron transport chain are maintained across different light intensities . Temperature typically should be maintained at 20-25°C with a 16h/8h light/dark cycle for consistent growth and protein expression .

What post-translational modifications occur in Lemna minor photosystem proteins and how do they differ from those in terrestrial plants?

Lemna minor photosystem proteins undergo specific post-translational modifications that differ from those in terrestrial plants like Arabidopsis. Western-immuno analyses reveal differences in migration behavior of several proteins including PSBA (D1), PSBB, PSBC, PSBO, and LHCB1 when separated by SDS-PAGE . These differences cannot be attributed simply to sequence variations, as genomic analyses show high conservation between Lemna and Arabidopsis photosynthesis proteins .

The most significant post-translational modification appears to be phosphorylation at threonine residues in PSII proteins. Anti-phospho-threonine immune blotting reveals distinct phosphorylation patterns in Lemna compared to Arabidopsis, with clear differences in both core and antenna proteins of PSII . These unique phosphorylation patterns may contribute to Lemna's high growth rates and efficient photosynthesis in aquatic environments.

How can researchers accurately assess PSII function and electron transport in recombinant Lemna minor protein studies?

To accurately assess PSII function and electron transport in studies involving recombinant Lemna minor proteins, researchers should employ multiple complementary techniques:

  • Chlorophyll fluorescence measurements using PAM (Pulse Amplitude Modulation) fluorometry to determine key parameters including:

    • Fv/Fm (maximum quantum efficiency of PSII)

    • ΦPSII (effective quantum yield under illumination)

    • qP (photochemical quenching)

    • NPQ (non-photochemical quenching)

  • 77K chlorophyll fluorescence emission experiments to assess antenna association with photosystems under different conditions (light/dark). This method can reveal changes in the F735/F686 ratio (PSI to PSII emission), which indicates shifts in relative antenna size .

  • Photoinhibition and recovery experiments using high-intensity light (e.g., 1800 μmol photons m⁻² s⁻¹) followed by monitoring Fv/Fm recovery kinetics to assess D1 protein damage and repair .

  • Western-immuno analyses with antibodies against photosynthetic proteins to detect both the recombinant protein and its interactions with native photosynthetic components .

What methodological challenges exist in isolating functional QB-binding protein from Lemna minor?

Isolating functional QB-binding protein from Lemna minor presents several methodological challenges:

  • Post-translational modifications: The presence of unique phosphorylation patterns in Lemna photosynthetic proteins requires careful consideration of buffer conditions to maintain these modifications during extraction .

  • Membrane protein solubility: As an integral membrane protein component of PSII, the QB-binding portion of the D1 protein requires appropriate detergents for solubilization without compromising function.

  • Protein stability: The D1 protein is known to be susceptible to rapid turnover, especially under light stress conditions, requiring rapid isolation procedures and potentially protease inhibitors .

  • Species-specific optimization: While antibodies against Arabidopsis proteins successfully detect Lemna photosynthetic proteins, the migration differences observed suggest that purification protocols optimized for terrestrial plants may require adjustment for Lemna proteins .

How should phosphorylation analysis be optimized for Lemna minor photosystem proteins?

For optimal phosphorylation analysis of Lemna minor photosystem proteins, researchers should employ the following methodological approach:

  • Timing of sample collection: Harvest material from both dark phase (when kinases are inactive) and 40-50 minutes after onset of light (when kinases are fully activated) to capture dynamic phosphorylation states .

  • Isolation buffer optimization: Use buffers containing phosphatase inhibitors (e.g., NaF, β-glycerophosphate) to preserve native phosphorylation states.

  • Detection technique: Apply anti-phospho-threonine immune blotting, which has been successfully demonstrated in Lemna despite being previously established primarily for terrestrial model plants .

  • Comparison standards: Include Arabidopsis samples prepared simultaneously as reference standards to identify Lemna-specific phosphorylation patterns .

  • Validation through multiple approaches: Complement western blotting with mass spectrometry to identify specific phosphorylation sites and proteomic analysis to quantify phosphorylation levels.

What controls and validations are essential when studying recombinant Lemna minor photosynthetic proteins?

When studying recombinant Lemna minor photosynthetic proteins, the following controls and validations are essential:

  • Expression verification: Confirm successful expression of the recombinant protein using western blotting with specific antibodies. Research shows that antibodies directed against Arabidopsis proteins successfully detect homologous proteins in Lemna .

  • Functional validation: Assess the photosynthetic functionality of recombinant proteins through:

    • Chlorophyll fluorescence parameters (Fv/Fm, ΦPSII)

    • Electron transport rate measurements

    • Oxygen evolution assays

  • Control comparisons:

    • Wild-type Lemna minor as a positive control

    • Arabidopsis thaliana as a comparative terrestrial reference

    • Non-transformed Lemna samples as negative controls

  • Post-translational modification assessment: Verify that recombinant proteins undergo appropriate modifications by comparing phosphorylation patterns with native proteins using anti-phospho-threonine immunoblotting .

  • Physiological response validation: Test recombinant protein function under variable conditions such as high light stress to confirm typical photoinhibition and recovery responses .

How can researchers distinguish between species-specific adaptations and experimental artifacts when comparing Lemna and terrestrial plant photosystems?

To distinguish between true species-specific adaptations and experimental artifacts when comparing Lemna minor and terrestrial plant photosystems, researchers should:

  • Standardize growth and experimental conditions: Ensure both species are grown under identical light intensities, temperature, and nutrient conditions to eliminate environmental variables as confounding factors .

  • Employ multiple analytical techniques: Use complementary approaches such as:

    • Western-immuno analyses for protein detection and quantification

    • Chlorophyll fluorescence measurements for functional assessment

    • 77K fluorescence emission spectra for antenna association studies

    • Anti-phospho-threonine immune blotting for phosphorylation patterns

  • Perform comprehensive protein characterization: Analyze sequence conservation between homologous proteins to determine if observed differences are due to amino acid variations or post-translational modifications .

  • Conduct time-course experiments: Assess responses to environmental changes (e.g., light/dark transitions, high light stress) over time to distinguish between constitutive adaptations and inducible responses .

  • Include multiple biological replicates: Ensure sufficient replication (n≥3) to account for natural variation and confirm statistical significance of observed differences .

What statistical approaches best address variability in Lemna minor photosynthetic protein studies?

For addressing variability in Lemna minor photosynthetic protein studies, the following statistical approaches are recommended:

  • Experimental design considerations:

    • Minimum of three biological replicates per condition

    • Randomized experimental units to minimize position effects

    • Inclusion of appropriate controls for each experimental batch

  • Statistical analysis methods:

    • One-way analysis of variance (ANOVA) with post-hoc Tukey-Kramer HSD test for multiple treatment comparisons

    • Repeated measures ANOVA for time-course experiments

    • Standard deviation reporting for transparency about variability

  • Data normalization strategies:

    • For growth studies: normalization of starting values to 1 before comparing growth rates

    • For protein analysis: normalization to total protein content or to housekeeping proteins

    • For chlorophyll fluorescence: careful baseline correction and instrument calibration

  • Visualization approaches:

    • Error bars representing standard deviation for all measurements

    • Color-coding by treatment conditions for clarity in complex datasets

How might understanding Lemna minor photosystem adaptations contribute to engineering stress-resistant photosynthetic systems?

Understanding the unique adaptations of Lemna minor photosystem proteins could significantly contribute to engineering stress-resistant photosynthetic systems through several approaches:

  • Post-translational modification engineering: The distinctive phosphorylation patterns observed in Lemna photosystem proteins could be transferred to crop plants to enhance photosynthetic efficiency under varying light conditions .

  • Improved light utilization: Lemna's superior quenching efficiencies suggest mechanisms for improved light utilization that could be incorporated into terrestrial crops to enhance photosynthetic performance under fluctuating light conditions .

  • Electron sink capacity optimization: The apparent lack of delayed Calvin cycle activation in Lemna (as indicated by fluorescence patterns) suggests mechanisms for maintaining strong electron sink capacity that could be valuable for engineering plants with improved carbon fixation efficiency .

  • Stress recovery mechanisms: The mechanisms underlying Lemna's recovery from photoinhibition could be incorporated into other plants to improve resilience to high light stress .

  • Aquatic-to-terrestrial adaptation strategies: Identifying the molecular adaptations that allow Lemna to thrive in aquatic environments could provide insights for engineering crops to better handle waterlogged conditions or fluctuating water availability .

What emerging technologies might enhance our understanding of Lemna minor photosystem structure-function relationships?

Several emerging technologies show promise for advancing our understanding of structure-function relationships in Lemna minor photosystems:

  • Advanced imaging techniques:

    • Cryo-electron microscopy to resolve the structure of Lemna photosynthetic complexes with their unique post-translational modifications

    • Video imaging approaches for monitoring Lemna multiplication at high magnification to assess photosynthesis and growth dynamics

  • High-throughput phenotyping:

    • Automated chlorophyll fluorescence imaging systems for rapid assessment of photosynthetic parameters across multiple treatment conditions

    • 2D imaging PAM for simultaneous comparison of multiple species or conditions

  • Multi-omics integration:

    • Combined proteomics, phosphoproteomics, and transcriptomics to correlate post-translational modifications with gene expression changes

    • Metabolomics to link photosynthetic efficiency to downstream metabolic outcomes

  • CRISPR-Cas9 gene editing:

    • Precise modification of phosphorylation sites to test their functional significance

    • Creation of Lemna lines with terrestrial plant-like photosystem components to isolate aquatic adaptation factors

  • Computational modeling:

    • Molecular dynamics simulations of Lemna photosystem proteins with their specific post-translational modifications

    • Systems biology approaches to model electron transport and energy dissipation pathways

What is the optimal protocol for isolating thylakoid membranes and photosystem proteins from Lemna minor?

The optimal protocol for isolating thylakoid membranes and photosystem proteins from Lemna minor involves the following steps:

  • Sample collection:

    • Harvest Lemna fronds at specific time points relative to light/dark cycle depending on the desired phosphorylation state

    • Immediately flash-freeze in liquid nitrogen if not processing immediately

  • Thylakoid membrane isolation:

    • Homogenize tissue in isolation buffer containing:

      • 330 mM sorbitol

      • 50 mM HEPES-KOH (pH 7.5)

      • 5 mM MgCl₂

      • 10 mM NaF (phosphatase inhibitor)

      • 1 mM PMSF (protease inhibitor)

    • Filter through miracloth and centrifuge at 1,000 × g for 5 minutes

    • Resuspend pellet and lyse chloroplasts in hypotonic buffer

    • Collect thylakoids by centrifugation at 10,000 × g for 10 minutes

  • Protein extraction:

    • Solubilize thylakoid membranes in buffer containing:

      • 50 mM Tris-HCl (pH 7.5)

      • 2% SDS

      • 10 mM NaF

      • Complete protease inhibitor cocktail

    • Incubate at room temperature for 30 minutes with gentle agitation

    • Centrifuge at 16,000 × g for 15 minutes to remove insoluble material

  • Protein analysis:

    • Separate proteins by SDS-PAGE

    • Transfer to PVDF membrane for western-immuno analysis

    • Use antibodies directed against Arabidopsis proteins, which successfully detect Lemna homologs

  • Phosphorylation analysis:

    • Perform anti-phospho-threonine immune blotting to detect phosphorylated thylakoid proteins

    • Compare phosphorylation patterns between dark-adapted and light-exposed samples

How should researchers design experiments to study light-dependent antenna association in recombinant Lemna photosystems?

When designing experiments to study light-dependent antenna association in recombinant Lemna photosystems, researchers should follow this methodological framework:

  • Experimental conditions setup:

    • Grow Lemna under controlled light conditions (e.g., 100-700 μmol photons m⁻² s⁻¹)

    • Maintain consistent temperature and nutrient conditions

    • Establish dark-adapted state by keeping plants in darkness for ≥30 minutes

  • Sample preparation for different light states:

    • Dark sample: Collect fronds from dark phase (STN7 kinase inactive)

    • Light sample: Collect fronds 50 minutes after onset of white light (STN7 kinase fully activated)

  • 77K chlorophyll fluorescence emission experiments:

    • Flash-freeze samples in liquid nitrogen

    • Record fluorescence emission spectra between 650-800 nm with excitation at 435 nm

    • Analyze ratio of fluorescence at 735 nm (PSI) to 686 nm (PSII)

    • Compare F735/F686 ratio between dark and light samples

  • Western blot analysis to correlate with antenna association:

    • Perform anti-phospho-threonine immunoblotting to detect LHCII phosphorylation

    • Analyze phosphorylation patterns of PSII antenna proteins

  • Controls and validation:

    • Include wild-type Lemna minor and Arabidopsis thaliana as references

    • Perform technical and biological replicates (n≥3)

    • Validate light-dependent changes with functional measurements of photosynthetic efficiency

What are common pitfalls in analyzing phosphorylation states of Lemna photosystem proteins and how can they be overcome?

Common pitfalls in analyzing phosphorylation states of Lemna photosystem proteins and their solutions include:

  • Rapid dephosphorylation during extraction:

    • Problem: Phosphatase activity during sample preparation can lead to loss of native phosphorylation patterns

    • Solution: Include multiple phosphatase inhibitors (10 mM NaF, 1 mM β-glycerophosphate) in all buffers and maintain samples at 4°C throughout processing

  • Misinterpretation of migration differences:

    • Problem: Differences in protein migration on SDS-PAGE between Lemna and reference species might be misattributed

    • Solution: Perform parallel analyses of sequence variations and phospho-specific immunoblotting to distinguish between sequence differences and post-translational modifications

  • Light-induced changes during sample handling:

    • Problem: Exposure to light during sample collection can alter phosphorylation states

    • Solution: Collect dark samples under green safe light and immediately freeze samples in liquid nitrogen

  • Antibody cross-reactivity issues:

    • Problem: Commercial antibodies may have different affinities for Lemna proteins compared to model species

    • Solution: Validate antibody specificity with purified Lemna proteins and consider using multiple antibodies targeting different epitopes

  • Insufficient resolution of phosphorylated isoforms:

    • Problem: Standard SDS-PAGE may not resolve closely migrating phosphorylated variants

    • Solution: Employ Phos-tag acrylamide gels specifically designed to enhance separation of phosphorylated proteins

How can researchers differentiate between native and recombinant photosystem proteins in Lemna transformation studies?

To differentiate between native and recombinant photosystem proteins in Lemna transformation studies, researchers should implement these strategies:

  • Epitope tagging:

    • Add small epitope tags (e.g., His, FLAG, HA) to recombinant proteins

    • Use tag-specific antibodies for selective detection

    • Position tags carefully to avoid disruption of protein function or complex assembly

  • Western blot optimization:

    • Use antibodies that can distinguish between native and recombinant variants based on size differences

    • Apply differential migration analysis as seen in the comparative studies between Lemna and Arabidopsis proteins

    • Optimize gel conditions to maximize separation of variants with small differences

  • Functional comparisons:

    • Assess photosynthetic parameters (Fv/Fm, ΦPSII) in transformants vs. wild-type

    • Compare high light stress response and recovery kinetics between native and recombinant systems

    • Analyze 77K chlorophyll fluorescence emission spectra to detect alterations in antenna association

  • Mass spectrometry approaches:

    • Use targeted mass spectrometry to identify peptides unique to the recombinant protein

    • Quantify relative abundance of native vs. recombinant proteins

    • Map post-translational modifications to determine if recombinant proteins undergo proper processing

  • Genetic strategies:

    • When possible, knock down native protein expression while introducing the recombinant variant

    • Use codon-optimized sequences for recombinant proteins to facilitate discrimination at the RNA level

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.