Recombinant Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its inclusion.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Lemniscomys barbarus (Barbary striped grass mouse)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAAILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVSSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Uniprot No.

Target Background

Function
Recombinant Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center in subunit 2 and heme a in subunit 1 to the active site in subunit 1—a binuclear center (BNC) composed of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2)?

Lemniscomys barbarus Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrial protein encoded by the MT-CO2 gene from the Barbary striped grass mouse (Lemniscomys barbarus). This protein functions as a critical component of the cytochrome c oxidase complex, which serves as the terminal enzyme in the mitochondrial respiratory electron transport chain. The full-length protein consists of 227 amino acids and is essential for cellular energy metabolism . The Lemniscomys barbarus species is a small rodent endemic to a narrow coastal zone in Morocco, Algeria, and Tunisia in Northwest Africa, with populations established since the early to mid-Pleistocene era .

What are the optimal storage conditions for recombinant MT-CO2 protein?

For optimal stability and activity retention of recombinant MT-CO2 protein:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 30-50% and store at -20°C to -80°C

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

Storage buffer typically consists of a Tris-based buffer with 50% glycerol, optimized specifically for this protein . When preparing aliquots, consider volumes appropriate for single-use experiments to minimize freeze-thaw damage.

How can researchers verify the purity and activity of recombinant MT-CO2?

Verification of recombinant MT-CO2 purity and activity should follow a multi-step approach:

Purity Assessment:

  • SDS-PAGE analysis with Coomassie staining (expect >90% purity)

  • Western blot using anti-MT-CO2 or anti-tag antibodies

  • Mass spectrometry to confirm molecular weight and sequence coverage

Activity Verification:

  • Cytochrome c oxidase activity assay measuring electron transfer rates

  • Oxygen consumption measurements in reconstituted systems

  • Protein-protein interaction assays with other respiratory chain components

Use purified recombinant protein as a positive control in your experiments, with data normalization to account for batch-to-batch variation. Document the specific lot number and purity percentage when reporting experimental results.

What reconstitution protocols are recommended for lyophilized MT-CO2?

For optimal reconstitution of lyophilized MT-CO2:

  • Briefly centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Allow the protein to fully dissolve by gentle mixing (avoid vortexing)

  • For long-term storage, add glycerol to a final concentration of 30-50%

  • Prepare single-use aliquots to avoid freeze-thaw cycles

The reconstitution buffer can be adjusted depending on downstream applications. For functional studies, consider using buffers that mimic physiological conditions (pH 7.2-7.4). For structural studies, higher protein concentrations (>1 mg/mL) may be required with stabilizing agents.

How does Lemniscomys barbarus MT-CO2 compare to MT-CO2 from other species?

Comparative analysis of MT-CO2 across species reveals important evolutionary and functional insights:

SpeciesAmino Acid LengthSequence Similarity to L. barbarus MT-CO2Habitat/DistributionNotable Differences
Lemniscomys barbarus227 aa100%North Africa coastal regions Reference sequence
Arvicanthis somalicus227 aa~96%East Africa (Somalia)Minor differences in transmembrane domains
Ailuropoda melanoleuca (Giant Panda)227 aa~85%Central ChinaAdaptations related to unique bamboo diet and metabolism
Mus musculus227 aa~94%WorldwideWell-studied model organism

What experimental approaches can elucidate MT-CO2's role in metabolic adaptation?

To investigate MT-CO2's role in metabolic adaptation, consider these experimental approaches:

  • Comparative Respirometry Studies:

    • Measure oxygen consumption rates in isolated mitochondria from L. barbarus and related species

    • Determine enzyme kinetics (Km, Vmax) across temperature gradients (15-40°C)

    • Assess the effects of pH and ionic strength on activity

  • Site-Directed Mutagenesis:

    • Target residues unique to L. barbarus MT-CO2

    • Create chimeric proteins with domains from related species

    • Analyze effects on assembly, stability, and catalytic efficiency

  • In vivo Metabolic Flux Analysis:

    • Use isotope-labeled substrates to track carbon metabolism

    • Compare respiratory chain efficiency across conditions mimicking natural habitat variations

    • Correlate with physiological adaptations of L. barbarus to its Mediterranean ecological niche

These approaches collectively provide insights into how MT-CO2 variations contribute to the metabolic adaptations that allow L. barbarus to thrive in its specific habitat from sea level up to 1000m in Mediterranean scrublands .

What are the implications of MT-CO2 sequence variations across different geographic populations of Lemniscomys barbarus?

The geographical distribution of Lemniscomys barbarus across Morocco, Algeria, and Tunisia presents an opportunity to study how MT-CO2 sequence variations correlate with local adaptations:

  • Population Genomics Approach:

    • Sequence MT-CO2 from specimens across the distribution range

    • Map sequence polymorphisms to geographic and environmental gradients

    • Apply selection pressure tests (dN/dS ratios) to identify signatures of adaptation

  • Functional Consequences Assessment:

    • Express and purify variant proteins from different populations

    • Compare thermostability and activity profiles under varying conditions

    • Assess protein-protein interaction differences with other respiratory components

  • Ecological Correlation:

    • Analyze whether sequence variations correspond to habitat-specific variables (temperature, altitude, humidity)

    • Consider the species' presence across diverse microhabitats from coastal dunes to argon savanna

    • Evaluate whether variations affect metabolic efficiency in different ecological contexts

This research could provide valuable insights into how mitochondrial proteins evolve in response to environmental pressures within a species with a relatively restricted geographic range.

What advanced analytical techniques are most suitable for studying MT-CO2 protein-protein interactions?

For comprehensive characterization of MT-CO2 protein-protein interactions, these advanced techniques offer complementary insights:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps interaction interfaces at peptide-level resolution

    • Provides dynamics information on binding-induced conformational changes

    • Sample preparation: Use deuterated buffers with varying incubation times

    • Data analysis: Peptide-level mass shift quantification to identify protected regions

  • Cryo-Electron Microscopy:

    • Visualizes MT-CO2 within the intact cytochrome c oxidase complex

    • Resolution potentially reaching 2-3Å for structural details

    • Sample requirements: Highly purified protein complexes (>95% purity)

    • Computational reconstruction: Requires 100,000+ particle images

  • Cross-linking Mass Spectrometry (XL-MS):

    • Identifies proximal amino acids between interacting proteins

    • Protocol elements:
      a. Use MS-cleavable crosslinkers (e.g., DSSO, DSBU)
      b. Optimize crosslinker concentration (0.5-2 mM) and reaction time
      c. Employ specialized search algorithms (e.g., XlinkX, MeroX)

    • Integration with structural models provides spatial constraints

These techniques collectively provide a multi-dimensional view of how MT-CO2 interacts with other respiratory chain components, potentially revealing species-specific interaction patterns that contribute to metabolic adaptation.

What expression systems are most suitable for producing functional recombinant MT-CO2?

The choice of expression system significantly impacts the yield and functionality of recombinant MT-CO2:

Expression SystemAdvantagesLimitationsRecommended Protocol Elements
E. coli- High yield
- Cost-effective
- Rapid production
- Lacks post-translational modifications
- May form inclusion bodies
- Use BL21(DE3) strain
- Induce at low temperature (16-18°C)
- Add membrane-mimicking detergents
Insect cells- Better folding of membrane proteins
- Some post-translational modifications
- More expensive
- Longer production time
- Baculovirus expression vector system
- Harvest 72-96h post-infection
- Use mild detergents for extraction
Mammalian cells- Native-like post-translational modifications
- Proper membrane insertion
- Highest cost
- Lowest yield
- Complex protocols
- HEK293 or CHO cells
- Stable cell line generation
- Optimize serum-free conditions

For most biochemical and structural studies, E. coli-expressed MT-CO2 provides sufficient quality and quantity , while functional studies may benefit from eukaryotic expression systems that better recapitulate native protein modifications.

What are the key considerations for designing mutation studies to identify critical functional domains in MT-CO2?

When designing mutation studies for MT-CO2 functional domain identification:

  • Target Selection Strategies:

    • Evolutionarily conserved residues across multiple species

    • Residues at predicted protein-protein interfaces

    • Amino acids unique to Lemniscomys barbarus compared to related species

    • Residues implicated in human MT-CO2 pathologies

  • Mutation Types to Consider:

    • Conservative substitutions (maintain chemical properties)

    • Non-conservative substitutions (alter chemical properties)

    • Alanine scanning of functional motifs

    • Deletion of small motifs (3-5 amino acids)

  • Functional Readouts:

    • Enzyme kinetics (Km, Vmax, substrate affinity)

    • Protein stability measurements (thermal shift assays)

    • Assembly into higher-order complexes

    • Electron transfer efficiency

  • Controls and Validation:

    • Include wild-type protein in all experiments

    • Verify protein expression and folding before functional tests

    • Perform rescue experiments where possible

    • Use computational predictions to guide experimental design

This systematic approach allows for detailed mapping of structure-function relationships within MT-CO2 and identification of regions critical for the protein's role in cellular respiration.

How might comparative studies between MT-CO2 from Lemniscomys barbarus and other species inform our understanding of mitochondrial evolution?

Comparative studies of MT-CO2 across species offer valuable evolutionary insights:

  • Phylogenetic Analysis Applications:

    • Reconstruct evolutionary relationships among rodent lineages

    • Estimate divergence times in correlation with habitat specialization

    • Identify signatures of selection in species with unique metabolic adaptations

  • Structure-Function Relationships:

    • Compare catalytic efficiencies across species from different ecological niches

    • Correlate sequence variations with functional parameters

    • Identify convergent evolution in species with similar metabolic demands

  • Metabolic Adaptation Mechanisms:

    • Investigate whether MT-CO2 variations contribute to the adaptation of L. barbarus to its specific Mediterranean habitat

    • Compare with species having different energy requirements

    • Study whether MT-CO2 co-evolves with other respiratory chain components

The Barbary striped grass mouse (L. barbarus), with its specific habitat requirements and evolutionary history dating to the early-mid Pleistocene , provides an excellent model for studying how mitochondrial proteins adapt to ecological niches.

What are the implications of studying MT-CO2 for understanding broader mitochondrial disease mechanisms?

Research on MT-CO2 has significant implications for mitochondrial disease understanding:

This research contributes to our fundamental understanding of mitochondrial respiratory chain function and may inform therapeutic strategies for mitochondrial disorders involving cytochrome c oxidase deficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.