Recombinant Lemur catta ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference when placing the order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time estimates, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Lemur catta (Ring-tailed lemur)
Target Names
Target Protein Sequence
MNENLFASFITPTIVGIPIVILIIMTPYIIFPSPTRLINNRLTSLQQWLVQLILKQLMSI HNTKGRTWSLMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAATVIKGFRHK TKASLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLV LTSISPATASITFIILTLLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is produced by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may directly participate in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its function in Lemur catta?

MT-ATP6 (ATP synthase subunit a) is a mitochondrial protein that forms part of the F0 component of ATP synthase, an enzyme complex crucial for ATP production during oxidative phosphorylation. In Lemur catta (Ring-tailed lemur), as in other mammals, this protein plays a vital role in maintaining the proton gradient necessary for ATP synthesis. The protein consists of 226 amino acids and is encoded by the mitochondrial genome . The conservation of this protein across primate species suggests its fundamental importance in cellular energy metabolism.

How should recombinant Lemur catta MT-ATP6 be stored to maintain optimal activity?

For optimal preservation of recombinant Lemur catta MT-ATP6 activity, the protein should be stored at -20°C or -80°C upon receipt, with the latter preferred for extended storage. Aliquoting the protein is necessary to avoid repeated freeze-thaw cycles, which can significantly degrade protein quality. Working aliquots may be stored at 4°C for up to one week . The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose (pH 8.0) or with 50% glycerol for stability . Researchers should note that maintaining proper storage conditions is critical for experimental reproducibility.

What are the structural differences between Lemur catta MT-ATP6 and human MT-ATP6?

Although the search results don't provide direct comparative structural data between Lemur catta and human MT-ATP6, this represents an important research question. Prosimian primates like lemurs are roughly half the genetic distance between mice and humans , suggesting potentially significant structural conservation with some key differences.

Researchers interested in this comparison should conduct sequence alignment analyses and structural prediction studies. The available full-length amino acid sequence of Lemur catta MT-ATP6 can be aligned with the human homolog to identify:

  • Conserved functional domains

  • Species-specific amino acid substitutions

  • Potential differences in post-translational modification sites

  • Evolutionary adaptations that might affect ATP synthesis efficiency

These structural differences may provide insights into primate evolution and energy metabolism adaptations.

How can Lemur catta MT-ATP6 be used as a model for studying mitochondrial diseases?

The recombinant Lemur catta MT-ATP6 offers a valuable research tool for studying mitochondrial diseases, particularly those affecting ATP synthesis. Lemurs represent an evolutionary intermediate between non-primate mammals and anthropoid primates, making them potentially useful models for human mitochondrial disorders .

Research approaches may include:

  • In vitro functional assays comparing wild-type and mutated forms of MT-ATP6

  • Integration into reconstituted membrane systems to assess proton translocation

  • Comparative studies with human MT-ATP6 mutations associated with diseases like NARP (Neuropathy, Ataxia, and Retinitis Pigmentosa) or Leigh syndrome

  • Structure-function relationship studies using site-directed mutagenesis

Mouse lemurs specifically have been identified as promising genetic model organisms for primate biology and health research, with efforts underway to establish comprehensive genetic resources for these animals .

What expression systems are optimal for producing high-quality recombinant Lemur catta MT-ATP6?

The commercially available recombinant Lemur catta MT-ATP6 is expressed in E. coli with an N-terminal His tag . This bacterial expression system offers advantages for producing reasonable quantities of the protein for research purposes.

  • E. coli expression: Advantages include high yield and cost-effectiveness, but potential limitations include lack of post-translational modifications and possible incorrect folding of membrane proteins.

  • Eukaryotic alternatives: For studies requiring properly folded and modified protein, insect or mammalian cell expression systems might be preferable despite lower yields.

  • Cell-free systems: These can be advantageous for membrane proteins like MT-ATP6, allowing for direct incorporation into artificial membrane environments.

The choice of expression system should be guided by the specific research questions and experimental requirements.

What reconstitution protocols maximize the stability and activity of Lemur catta MT-ATP6?

For optimal reconstitution of lyophilized recombinant Lemur catta MT-ATP6:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) for long-term storage

  • Aliquot to minimize freeze-thaw cycles and store at -20°C/-80°C

For functional studies, additional considerations include:

  • Buffer composition optimization (pH, salt concentration)

  • Incorporation into liposomes or nanodiscs for activity assays

  • Use of detergents compatible with membrane protein stability

  • Addition of stabilizing agents such as trehalose or sucrose

These reconstitution parameters should be systematically optimized for specific experimental applications.

How should researchers quantify MT-ATP6 activity and what controls are essential?

Although the search results don't provide specific activity assay protocols for MT-ATP6, standard approaches for ATP synthase activity quantification would include:

  • ATP synthesis assays: Measuring ATP production using luminescence-based detection systems

  • Proton translocation measurements: Using pH-sensitive fluorescent dyes to monitor proton movement

  • Oxygen consumption assays: Measuring respiratory activity in reconstituted systems

Essential controls include:

Control TypePurposeImplementation
Negative controlEstablish baselineHeat-inactivated MT-ATP6
Positive controlValidate assayWell-characterized ATP synthase (e.g., bovine)
Inhibitor controlConfirm specificityOligomycin treatment
Substrate controlsVerify dependenceAssays with/without ADP, Pi
System controlsAssess reconstitutionProtein-free liposomes

Data should be analyzed using appropriate statistical methods, accounting for technical and biological replicates.

What approaches can be used to study the interaction of MT-ATP6 with other components of the ATP synthase complex?

To investigate interactions between recombinant Lemur catta MT-ATP6 and other ATP synthase components, researchers might employ:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag or MT-ATP6 to pull down interaction partners

  • Surface Plasmon Resonance (SPR): Quantifying binding kinetics between MT-ATP6 and other subunits

  • Crosslinking studies: Identifying proximity between protein components

  • Reconstitution experiments: Systematically incorporating multiple purified components to assess functional restoration

  • Cryo-electron microscopy: Visualizing structural arrangements of the complete complex

The His-tagged recombinant protein provides a convenient handle for many of these interaction studies, allowing for specific isolation and detection of the MT-ATP6 component.

What can Lemur catta MT-ATP6 teach us about the evolution of mitochondrial function in primates?

Lemur catta, as a prosimian primate, occupies an important phylogenetic position for understanding primate evolution. Studies of MT-ATP6 from lemurs can provide insights into:

  • Evolutionary conservation of mitochondrial function across primates

  • Adaptive changes in energy metabolism that might correlate with different ecological niches

  • Molecular basis for differences in metabolic efficiency between primate lineages

Mouse lemurs specifically have been identified as valuable model organisms that are roughly half the genetic distance between mice and humans . This intermediate position makes them particularly valuable for comparative studies of mitochondrial function.

The complete amino acid sequence available for Lemur catta MT-ATP6 enables comparative genomic analyses with other primates, potentially revealing selection pressures on this critical metabolic protein.

How does the use of recombinant MT-ATP6 compare with studies in living lemur models?

While recombinant protein studies offer valuable insights into biochemical properties and structural features of MT-ATP6, they have limitations compared to studies in living lemur models:

  • Recombinant protein advantages:

    • Allows precise biochemical characterization

    • Enables structure-function studies through mutagenesis

    • Provides material for interaction studies and drug screening

  • Living model advantages:

    • Captures physiological context and regulation

    • Enables study of tissue-specific effects

    • Allows for assessment of age-related changes

Mouse lemurs have been established as promising genetic model organisms for primate biology . They offer advantages including small size, fast development, and high reproductive rate, making them more practical for laboratory studies than larger primates while still retaining relevant primate biology.

The integration of findings from both recombinant protein studies and living models provides the most comprehensive understanding of MT-ATP6 function and its role in primate biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.