Recombinant Lemur catta Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Lemur catta (Ring-tailed lemur)
Target Names
Target Protein Sequence
MAYPVQLGFQDAASPIMEELLYFHDHTLMIMFLISSLVLYIISLMLTTELMHTNTMDAQE VETVWTILPAAILILIALPSLRILYMMDEITTPSLTLKTMGHQWYWSYEYTDYEDLCFDS YMTPSSDLKPGELRLLEVDNRVVLPTELAVRMLISSEDVLHSWTVPSLGVKTDAIPGRLN QATLMASRPGVYYGQCSEICGANHSFMPIVLELVPLKHFEEWLLSML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprised of Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1, consisting of heme a3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its role in cellular metabolism?

MT-CO2 (mitochondrially encoded cytochrome c oxidase II) is a protein subunit of the cytochrome c oxidase complex, which functions as the terminal enzyme in the mitochondrial electron transport chain. In Lemur catta (ring-tailed lemur), this protein plays a critical role in cellular respiration by contributing to cytochrome-c oxidase activity, facilitating the transfer of electrons from cytochrome c to molecular oxygen, and participating in the positive regulation of vasoconstriction . The protein is located in the mitochondrial inner membrane and forms an integral part of respiratory chain complex IV . Its function is essential for aerobic metabolism and ATP production in lemur cells, making it a key element in understanding primate metabolic adaptations.

How does MT-CO2 from Lemur catta compare with homologous proteins in other primates?

MT-CO2 is highly conserved across primates but contains species-specific variations that reflect evolutionary adaptations. When comparing the Lemur catta MT-CO2 sequence with homologous proteins from other primates, researchers should focus on:

  • Conserved functional domains involved in electron transport

  • Species-specific amino acid substitutions that may correlate with metabolic adaptations

  • Variations in post-translational modifications

These comparative analyses can provide insights into primate evolution and metabolic adaptations to different ecological niches. For instance, the lower energy expenditure observed in ring-tailed lemurs compared to brown lemurs (after controlling for body mass) may partially relate to adaptations in mitochondrial proteins like MT-CO2 . Such adaptations likely reflect evolutionary pressures to cope efficiently with seasonally low-quality foods and water scarcity in their natural habitats .

What are the optimal storage conditions for recombinant Lemur catta MT-CO2 protein?

For maintaining maximum stability and activity of recombinant Lemur catta MT-CO2 protein, researchers should adhere to the following storage protocols:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Standard storage: Maintain at -20°C in storage buffer containing Tris-based buffer with 50% glycerol

  • Extended storage: Preserve at -20°C or -80°C, with the latter preferred for long-term archiving

Critically, repeated freezing and thawing should be avoided as this leads to protein denaturation and loss of activity . The recommended approach is to prepare small working aliquots during initial handling to minimize freeze-thaw cycles. The storage buffer is optimized specifically for this protein to maintain its native conformation and activity .

How can researchers effectively use recombinant MT-CO2 in enzyme-linked immunosorbent assays (ELISA)?

When employing recombinant Lemur catta MT-CO2 in ELISA-based applications, researchers should follow this methodological framework:

  • Protein reconstitution: Carefully reconstitute the lyophilized protein (typically provided as 50 μg quantity) following manufacturer recommendations to ensure proper solubilization

  • Coating optimization: Determine optimal coating concentration through titration experiments (typically 1-10 μg/ml in carbonate-bicarbonate buffer, pH 9.6)

  • Blocking protocol: Use 3-5% BSA or similar blocking agent to minimize non-specific binding

  • Antibody selection: Choose antibodies with validated cross-reactivity to Lemur catta MT-CO2, considering that antibodies raised against human MT-CO2 may show variable cross-reactivity

  • Calibration curve: Establish a standard curve using purified MT-CO2 at concentrations ranging from 0.1-1000 ng/ml

This approach enables quantitative assessment of MT-CO2 levels in biological samples from ring-tailed lemurs, facilitating comparative studies of mitochondrial function across different physiological states or experimental conditions.

What methodologies are recommended for studying MT-CO2 in the context of energy metabolism in Lemur catta?

For investigating MT-CO2's role in energy metabolism, researchers should consider these methodological approaches:

  • Doubly labeled water (DLW) studies: This technique has been successfully employed to measure total energy expenditure (TEE) in free-living Lemur catta . The protocol involves:

    • Capture and anesthesia (typically using ketamine 15 mg/kg)

    • Collection of baseline blood samples

    • Administration of isotopically labeled water

    • Recapture after 3-4 days for follow-up sampling

  • Respirometry: Measure oxygen consumption and CO₂ production to assess mitochondrial function

  • Tissue biopsies: Collect small muscle or adipose tissue samples for ex vivo analysis of MT-CO2 expression and activity

  • Correlation studies: Relate MT-CO2 expression/activity levels to physiological parameters (body mass, body composition, seasonal variations)

Research has shown that ring-tailed lemurs exhibit lower water flux rates and energy expenditure than related species after controlling for body mass differences, suggesting metabolic adaptations to resource-limited environments . These methods allow researchers to explore how MT-CO2 variations might contribute to such adaptations.

How can MT-CO2 serve as a biomarker for mitochondrial disorders in comparative primate studies?

MT-CO2 has significant potential as a biomarker for mitochondrial disorders across primate species. In humans, MT-CO2 variations are associated with conditions like MELAS syndrome (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes) and serve as biomarkers for Huntington's disease and stomach cancer . For comparative primate studies:

  • Sequence analysis: Identify conserved regions across primates that, when mutated, associate with pathological conditions

  • Functional assays: Measure cytochrome c oxidase activity in tissue samples from healthy and diseased subjects

  • Expression profiling: Quantify MT-CO2 mRNA and protein levels across different tissues and pathological states

  • Biomarker validation: Correlate MT-CO2 variants or expression levels with specific disease phenotypes

Disease AssociationHuman MT-CO2Lemur catta MT-CO2Research Applications
MELAS syndromeEstablished biomarkerAssociation being investigatedComparative metabolism studies
Huntington's diseaseBiomarkerPotential comparative modelNeurodegeneration research
Stomach cancerBiomarkerUnknown associationComparative oncology

This comparative approach can illuminate evolutionary aspects of mitochondrial disease susceptibility and potentially identify novel therapeutic targets.

What experimental approaches can elucidate the functional differences between MT-CO2 and MT-CO3 in Lemur catta?

To investigate functional differences between MT-CO2 and MT-CO3 in Lemur catta, researchers should implement these complementary approaches:

  • Structural comparison: Compare the amino acid sequences of MT-CO2 (227 amino acids) and MT-CO3 (274 amino acids) , focusing on functional domains and binding sites

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify differential binding partners

    • Yeast two-hybrid screening to map interaction networks

    • Proximity labeling techniques to identify spatial relationships within complex IV

  • Site-directed mutagenesis:

    • Generate variants with mutations in specific functional regions

    • Assess the impact on enzyme activity and stability

    • Compare effects of equivalent mutations in MT-CO2 versus MT-CO3

  • Functional reconstitution assays:

    • In vitro reconstitution of cytochrome c oxidase with either wild-type or modified MT-CO2/MT-CO3

    • Measure electron transfer rates and oxygen consumption

These approaches can reveal how the structural differences between these subunits translate to functional specialization within the cytochrome c oxidase complex and potentially identify subunit-specific roles in lemur metabolic adaptations.

How can genomic analysis of MT-CO2 inform our understanding of Lemur catta evolutionary adaptations?

Genomic analysis of MT-CO2 provides valuable insights into evolutionary adaptations of Lemur catta. Researchers should consider:

  • Phylogenetic analysis:

    • Construct phylogenetic trees based on MT-CO2 sequences across primate lineages

    • Identify patterns of conservation and divergence

    • Calculate evolutionary rates in different primate lineages

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Compare selection patterns between lemurs and other primates

    • Correlate selection patterns with ecological adaptations

  • Population genetics:

    • Assess MT-CO2 variation within Lemur catta populations

    • Identify genetic signatures of population bottlenecks or expansions

    • Correlate genetic variation with geographic distribution and habitat differences

  • Functional implications:

    • Model how sequence variations affect protein structure and function

    • Correlate genetic variations with observed metabolic differences

    • Experimentally validate the impact of lemur-specific MT-CO2 variants

These approaches can help explain the observed lower energy expenditure in ring-tailed lemurs compared to other species , potentially linking specific MT-CO2 variants to enhanced metabolic efficiency in resource-limited environments.

What are common challenges in expressing and purifying recombinant Lemur catta MT-CO2?

Researchers working with recombinant Lemur catta MT-CO2 frequently encounter these challenges:

  • Expression system selection: Mitochondrial proteins often face expression difficulties in standard bacterial systems due to differences in codon usage and post-translational modifications

  • Protein solubility: As a membrane protein, MT-CO2 tends toward aggregation and inclusion body formation

  • Functional reconstitution: Maintaining native conformation and activity during purification

Recommended troubleshooting strategies include:

  • Expression optimization:

    • Test multiple expression systems (bacterial, yeast, insect, mammalian)

    • Optimize codon usage for the expression host

    • Use fusion tags that enhance solubility (SUMO, MBP, TRX)

    • Express at lower temperatures (16-25°C) to slow folding

  • Purification approaches:

    • Include appropriate detergents during lysis and purification

    • Use mild solubilization conditions to maintain native structure

    • Consider on-column refolding techniques for proteins recovered from inclusion bodies

  • Activity verification:

    • Develop functional assays to confirm that purified protein retains native activity

    • Compare activity with native MT-CO2 isolated from lemur tissue samples

These strategies help overcome the intrinsic challenges of working with mitochondrial membrane proteins while preserving their structural and functional integrity.

How can researchers address cross-reactivity issues when developing antibodies against Lemur catta MT-CO2?

Developing specific antibodies against Lemur catta MT-CO2 presents several challenges:

  • Sequence homology with other species: High conservation across primates can lead to cross-reactivity

  • Cross-reactivity with MT-CO3: Structural similarities between MT-CO2 and MT-CO3 may cause antibody cross-reactivity

  • Limited availability of negative controls: Validating specificity can be difficult without MT-CO2 knockout controls

Recommended methodological approaches include:

  • Epitope selection:

    • Identify Lemur catta-specific regions within the MT-CO2 sequence

    • Focus on surface-exposed regions predicted by structural analysis

    • Target regions with maximum divergence from MT-CO3 and other potential cross-reactive proteins

  • Validation strategy:

    • Perform Western blot analysis against recombinant MT-CO2 and MT-CO3

    • Include competitive blocking with specific peptides

    • Test against tissues from multiple primate species to assess cross-reactivity

  • Antibody purification:

    • Use affinity purification against specific epitopes

    • Perform negative selection against potentially cross-reactive proteins

    • Validate using immunohistochemistry on lemur tissue samples with known MT-CO2 expression patterns

These approaches maximize antibody specificity while minimizing cross-reactivity issues, enabling more reliable detection and quantification of MT-CO2 in research applications.

How does MT-CO2 activity correlate with the unique energy metabolism observed in Lemur catta?

The relationship between MT-CO2 activity and Lemur catta's distinctive energy metabolism represents an important research area:

This research direction has significant implications for understanding primate adaptations to resource-limited environments and potentially for human mitochondrial disease research.

What techniques are recommended for studying MT-CO2 in the context of seasonal metabolic adaptations in Lemur catta?

For investigating MT-CO2's role in seasonal metabolic adaptations, researchers should employ these methodological approaches:

  • Longitudinal sampling:

    • Collect tissue samples (blood, muscle biopsies) across different seasons

    • Track changes in MT-CO2 expression and activity

    • Correlate with environmental variables (food availability, temperature)

  • Body composition assessment:

    • Use doubly labeled water techniques to measure body composition

    • Track seasonal changes in fat mass and lean mass

    • Correlate with MT-CO2 expression levels

  • Field metabolic measurements:

    • Measure total energy expenditure using doubly labeled water in free-living lemurs

    • Compare energy expenditure between wet and dry seasons

    • Correlate seasonal changes with MT-CO2 activity

  • Experimental design recommendations:

SeasonParameters to MeasureMethodologyExpected MT-CO2 Correlation
End of rainy seasonBody fat content, TEEDLW method, capture-recaptureHigh body fat correlates with altered MT-CO2 activity
Dry seasonWater flux rates, energy expenditureDLW method, urine/blood samplingLower energy expenditure correlates with adapted MT-CO2 function
Transition periodsRate of metabolic adaptationRepeated measurements, tissue samplingMT-CO2 expression changes precede metabolic adaptation

This research framework enables investigation of how MT-CO2 contributes to the documented ability of ring-tailed lemurs to efficiently cope with seasonally low-quality foods and water scarcity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.