Recombinant Lemur catta Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Lemur catta (Ring-tailed lemur)
Target Names
Target Protein Sequence
MPVQGSQRSLLGAVNSTPTATPHLRPAANQTGPQCLEVSIPDGLFLCLGLVSLVENTLVV AAIAKNRNLHSPMYCFICCLALSDLLVSVSSVLETAVLLLLGAGALAAQATVVQQLGNVI DVLLCSSMVSSLFFLGAIAMDRYISIFYALRYHSIVTLARARRAIAAIWAASILSSTLFI AYCDRTAALLCLVVFFLAMLVLMAVLYVHMLTQARQHAQGIARLHKRQRPVQQGWGLKGA ATLTILLGVFFLCWGPFFLHLTLIAVCPQHPTCSCIFKNFRLFLALIVCNAIVDPLIYAF RSQELRKTLKEVLLFFW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) acts as a receptor for alpha, beta, and gamma MSH and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the process of producing eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Melanocyte-stimulating hormone receptor (MC1R) in Lemur catta?

The Melanocyte-stimulating hormone receptor (MC1R) in Lemur catta (Ring-tailed lemur) is a G protein-coupled receptor that plays a critical role in regulating melanin synthesis and pigmentation . This protein is also referred to as MSH-R or Melanocortin receptor 1 (MC1-R) in scientific literature . The full-length protein consists of 317 amino acids and functions primarily in the melanocyte cell membrane to control the production of different types of melanin (eumelanin and pheomelanin) in response to hormonal stimulation . Unlike some other primates, lemurs show interesting variations in MC1R functionality that may relate to their unique evolutionary history and ecological adaptations .

The receptor's primary function involves binding melanocyte-stimulating hormone (MSH), which activates adenylyl cyclase and increases intracellular cAMP levels, ultimately influencing melanin production pathways . The specific characteristics of Lemur catta MC1R make it a valuable subject for comparative studies examining pigmentation genetics across primate lineages.

How should researchers properly handle recombinant Lemur catta MC1R in laboratory settings?

Proper handling of recombinant Lemur catta MC1R requires adherence to specific storage and experimental protocols to maintain protein integrity and functionality :

Storage recommendations:

  • Store at -20°C for regular use

  • For extended storage, maintain at -20°C or preferably -80°C

  • Avoid repeated freeze-thaw cycles as they can compromise protein structure and activity

  • For short-term work, prepare working aliquots that can be stored at 4°C for up to one week

Buffer considerations:

  • The recombinant protein is typically supplied in a Tris-based buffer with 50% glycerol optimized for stability

  • The buffer composition should be considered when designing experiments to avoid potential interference with assay systems

When using recombinant Lemur catta MC1R for functional studies, researchers should:

  • Minimize exposure to room temperature

  • Use sterile technique to prevent contamination

  • Consider the presence of any tags (determined during production) when designing binding or functional assays

  • Include appropriate controls to account for buffer components in experimental designs

How do functional variations in MC1R contribute to pigmentation differences across primate species?

MC1R functional variations have significant impacts on pigmentation across primate species, with notable differences between lemurs, humans, and other primates :

In humans, MC1R variants show clear associations with pigmentation phenotypes:

  • Loss-of-function variants (R alleles like rs1805007, rs1805008, rs1805009) significantly impair receptor signaling and are associated with red hair and fair skin

  • Milder effect variants (r alleles like rs1805005, rs2228479, rs885479) show reduced but not abolished function

  • Complete loss-of-function null variants (rs312262906, rs555179612) have been identified and have strong phenotypic effects

Lemurs represent yet another evolutionary pattern. In Lemur catta, MC1R function has distinctive characteristics that likely evolved separately from the hominoid and cercopithecoid lineages, potentially reflecting adaptation to Madagascar's unique ecological conditions .

Research comparing MC1R function across these lineages reveals that:

  • Different evolutionary pressures have shaped MC1R function across primate lineages

  • Similar phenotypes may arise from different molecular mechanisms

  • The relationship between MC1R sequence and pigmentation is not always straightforward and may involve interaction with other genetic and environmental factors

What experimental approaches are optimal for studying MC1R signaling pathways in Lemur catta?

Studying MC1R signaling pathways in Lemur catta requires multiple complementary experimental approaches:

Cell-Based Functional Assays:

  • cAMP accumulation assays to measure receptor activation following α-MSH stimulation

  • Basal activity measurements to assess constitutive receptor function

  • Dose-response studies with various MC1R agonists and antagonists

  • Heterologous expression systems (typically HEK293 or COS cells) transfected with Lemur catta MC1R constructs

Molecular Biology Techniques:

  • Site-directed mutagenesis to investigate specific amino acid contributions to receptor function

  • Chimeric receptor constructs to identify critical functional domains

  • CRISPR/Cas9 genome editing of melanocyte cell lines to study endogenous receptor function

Comparative Genomic Approaches:

  • Analysis of MC1R sequence conservation across lemur species

  • Identification of polymorphisms within wild Lemur catta populations

  • Correlation of genetic variants with coat color phenotypes in captive and wild populations

A comprehensive experimental workflow might include:

  • Cloning the full-length Lemur catta MC1R from genomic DNA or synthesizing based on reference sequence

  • Expressing the receptor in appropriate cell systems

  • Characterizing basal and stimulated activity profiles

  • Comparing results with MC1R from other primates to identify lemur-specific signaling characteristics

  • Correlating functional findings with population genetics data from wild lemurs

How can recombinant Lemur catta MC1R be used in comparative evolutionary studies?

Recombinant Lemur catta MC1R serves as a valuable tool in comparative evolutionary studies examining the molecular basis of adaptation across primate lineages:

Functional Divergence Analysis:
Recombinant MC1R proteins from multiple primate species, including Lemur catta, can be expressed and functionally characterized to determine how receptor properties have evolved over time . This approach has revealed that fixed differences in MC1R sequence can result in different functional characteristics that potentially contribute to divergence in coloration among closely related species .

Evolutionary Rate Comparison:
Comparing the rates of synonymous and non-synonymous substitutions in MC1R across primates can identify signatures of selection. Lemur catta MC1R provides a crucial data point representing strepsirrhine primates, which diverged from anthropoid primates over 60 million years ago .

Ecological Adaptation Studies:
The unique social and ecological characteristics of Lemur catta populations in Madagascar provide context for understanding selective pressures on MC1R function . Ring-tailed lemurs live in multi-male female groups (typically 10-20 individuals) with females remaining in their natal groups while males migrate . This social structure, combined with their habitat in dry forests and bush of southern Madagascar, creates distinct selective environments that may have shaped MC1R evolution.

Experimental Design Example:
A comprehensive comparative study might include:

  • Functional characterization of recombinant MC1R from:

    • Multiple lemur species (including Lemur catta)

    • Other strepsirrhine primates

    • Representative anthropoid primates

    • Non-primate outgroups

  • Measurement of key parameters:

    • Basal receptor activity

    • α-MSH binding affinity and potency

    • Signal transduction efficiency

    • Membrane expression levels

  • Correlation with habitat variables:

    • UV exposure levels

    • Temperature ranges

    • Predator pressure

    • Social signaling requirements

Such studies contribute to our understanding of how molecular function evolves in response to ecological pressures and how similar phenotypes may arise through different molecular mechanisms across separated lineages.

What are the challenges in expressing and purifying functional recombinant Lemur catta MC1R?

Expressing and purifying functional recombinant Lemur catta MC1R presents several significant challenges that researchers must address:

Expression System Selection:
As a seven-transmembrane G protein-coupled receptor, MC1R requires a membrane environment for proper folding and function . Researchers must carefully select expression systems:

  • Bacterial systems (E. coli): High yield but often result in misfolded protein requiring refolding

  • Insect cells (Sf9, High Five): Better for membrane protein expression but lower yield

  • Mammalian cells (HEK293, CHO): Provide proper post-translational modifications but are more expensive and have lower yield

Solubilization and Stability:

  • MC1R is naturally embedded in lipid membranes, requiring careful solubilization with detergents

  • The choice of detergent significantly impacts protein stability and function

  • Common detergents include:

    • DDM (n-Dodecyl β-D-maltoside)

    • LMNG (Lauryl maltose neopentyl glycol)

    • Digitonin or GDN (Glyco-diosgenin)

Purification Challenges:

  • Affinity tags must be selected carefully to minimize interference with receptor function

  • The tag type for recombinant Lemur catta MC1R is determined during the production process

  • Multi-step purification is typically required:

    • Affinity chromatography (His-tag or Flag-tag)

    • Size exclusion chromatography

    • Ion exchange chromatography if needed

Functional Verification:

  • Functional assays must verify that the purified receptor retains:

    • Proper folding

    • Ligand binding capability

    • Ability to activate G proteins or β-arrestin pathways

  • Techniques include:

    • Radioligand binding assays

    • Thermostability assays

    • Microscale thermophoresis for binding kinetics

    • Reconstitution in lipid nanodiscs for functional studies

Storage Stability:
The recombinant protein requires specific storage conditions to maintain stability:

  • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Avoidance of repeated freeze-thaw cycles

  • Preparation of working aliquots for short-term use

How does MC1R function correlate with evolutionary adaptations in wild Lemur catta populations?

The relationship between MC1R function and evolutionary adaptations in wild Lemur catta populations represents an intriguing research area connecting molecular mechanisms to ecological adaptations:

Population Genetics Context:
Ring-tailed lemurs inhabit the dry forests and bush of southern and southwestern Madagascar, with distinct populations showing potential local adaptations . Long-term studies at the Beza Mahafaly Reserve have provided demographic and behavioral data that can be integrated with genetic analyses to understand evolutionary pressures .

Social Structure Influences:
Lemur catta live in multi-male female groups (10-20 individuals) with female philopatry (females remain in natal groups) and male migration between groups . This social structure creates distinct patterns of genetic flow that influence the distribution and maintenance of MC1R variants:

  • Mitochondrial DNA analyses reveal matrilineal structure within populations

  • Nuclear markers like MC1R show different patterns of variation reflecting male-mediated gene flow

Adaptive Hypothesis Testing:
Research integrating MC1R functional data with field observations can test several hypotheses:

  • UV Protection Hypothesis:

    • MC1R variants affecting eumelanin production may correlate with UV exposure levels in different habitats

    • Populations in more open, sun-exposed areas might show selection for variants increasing eumelanin

  • Thermoregulation Hypothesis:

    • Coat color affects heat absorption and loss

    • MC1R variants might correlate with temperature patterns across the species' range

  • Social Signaling Hypothesis:

    • Ring-tailed lemurs rely on visual cues for social communication

    • MC1R variants affecting distinctive coloration patterns may be maintained by social selection

Methodological Approach:
A comprehensive study would integrate:

  • Field collection of genetic samples from multiple wild populations

  • MC1R sequencing and identification of population-specific variants

  • Functional characterization of variant receptors using recombinant protein expression

  • Correlation of variant frequencies with:

    • Environmental variables (UV index, temperature ranges)

    • Social structure variables (group size, sex ratio)

    • Phenotypic measurements (coat color, pattern)

Such research would contribute to our understanding of how molecular function translates to adaptive fitness in specific ecological contexts, bridging the gap between laboratory biochemistry and field evolutionary biology.

What protocols are most effective for studying MC1R activation in lemur cell systems?

Studying MC1R activation in lemur cell systems requires specialized protocols optimized for primate cells and MC1R signaling pathways:

Cell System Options:

  • Primary melanocytes isolated from Lemur catta skin samples

    • Advantages: Express native receptor and signaling components

    • Challenges: Limited availability, short lifespan in culture

  • Immortalized lemur cell lines

    • Advantages: Renewable resource, consistent performance

    • Challenges: Few established lemur cell lines, potential loss of normal signaling

  • Heterologous expression systems

    • Advantages: Widely available, well-characterized

    • Options:

      • HEK293 cells for high transfection efficiency

      • COS-7 cells for primate cell background

      • Melanoma cell lines (B16, Melan-a) for melanocyte-specific machinery

Activation Measurement Protocols:

  • cAMP Accumulation Assay:

    • Most direct measurement of MC1R activation

    • Protocol outline:
      a. Plate cells in appropriate medium (24-48 hours pre-assay)
      b. Optional: Pretreat with phosphodiesterase inhibitors (e.g., IBMX)
      c. Stimulate with α-MSH or other MC1R agonists
      d. Lyse cells and measure cAMP via ELISA or other detection methods
      e. Generate dose-response curves and calculate EC50 values

  • Calcium Mobilization Assay:

    • Measures secondary signaling events

    • Uses fluorescent calcium indicators (Fluo-4, Fura-2)

    • Provides real-time kinetic data

  • Reporter Gene Assays:

    • Measures downstream transcriptional effects

    • Constructs with cAMP-responsive elements driving luciferase/GFP expression

    • Provides amplified signal for low-abundance receptors

Comparative Evaluation Parameters:
To fully characterize Lemur catta MC1R, researchers should measure:

  • Basal activity (without agonist stimulation)

  • Maximum response amplitude

  • EC50 values for various agonists

  • Antagonist inhibition profiles

  • Desensitization and internalization kinetics

These protocols allow researchers to compare MC1R functionality across different lemur populations and between lemurs and other primate species, contributing to our understanding of MC1R evolution and adaptation.

How can researchers effectively analyze MC1R genetic variants in wild Lemur catta populations?

Analyzing MC1R genetic variants in wild Lemur catta populations requires a systematic approach that addresses the challenges of field sample collection, genetic analysis, and phenotype correlation:

Field Sampling Strategy:

  • Population selection:

    • Sample multiple populations across different habitats (e.g., Beza Mahafaly Reserve)

    • Include populations with varying coat color phenotypes

    • Consider both protected and unprotected areas to assess potential human impacts

  • Sample collection:

    • Non-invasive methods where possible (fecal samples, hair samples)

    • Minimally invasive methods when necessary (small blood samples, buccal swabs)

    • Proper preservation in field conditions (silica desiccation, RNAlater, ethanol)

  • Documentation:

    • Detailed recording of GPS coordinates

    • Photographic documentation of individual phenotypes

    • Collection of environmental data (UV index, temperature, habitat type)

Genetic Analysis Workflow:

  • DNA extraction:

    • Optimize protocols for potentially degraded field samples

    • Quantify DNA yield and quality (Nanodrop, Qubit, gel electrophoresis)

  • MC1R amplification:

    • Design primers specific to conserved regions flanking Lemur catta MC1R

    • Consider nested PCR approaches for low-quality samples

    • Use high-fidelity polymerases to minimize amplification errors

  • Sequencing approaches:

    • Sanger sequencing for targeted MC1R analysis

    • Next-generation sequencing for broader genomic context

    • Long-read sequencing to capture haplotype structure

  • Variant identification:

    • Alignment to reference Lemur catta MC1R sequence

    • Automated variant calling with manual verification

    • Annotation of variants (synonymous, non-synonymous, regulatory)

Population Genetics Analysis:

  • Variant frequency calculation:

    • Allele frequencies within and between populations

    • Tests for Hardy-Weinberg equilibrium

    • FST and other measures of population differentiation

  • Selection analysis:

    • dN/dS ratios to detect selective pressure

    • Extended haplotype homozygosity tests

    • Tajima's D and other neutrality tests

  • Association testing:

    • Correlation of MC1R variants with coat color phenotypes

    • Environmental association analysis

    • Integration with social structure data (matrilines, group composition)

This comprehensive approach enables researchers to understand how MC1R genetic variation is distributed in wild Lemur catta populations and how it relates to adaptation and population structure in their natural habitat.

What specialized equipment and reagents are required for functional studies of Lemur catta MC1R?

Conducting comprehensive functional studies of Lemur catta MC1R requires specialized equipment and reagents across multiple research domains:

Molecular Biology Equipment:

  • Thermal cyclers with gradient capability for PCR optimization

  • Real-time PCR system for gene expression quantification

  • Electrophoresis systems (standard and pulse-field)

  • DNA sequencing platform (Sanger or NGS)

  • Microvolume spectrophotometer for nucleic acid quantification

  • Bacterial incubators and shakers for cloning work

Cell Culture Facility Requirements:

  • CO2 incubators with humidity control

  • Laminar flow biosafety cabinets (Class II)

  • Inverted phase-contrast microscope

  • Cell counting system (hemocytometer or automated counter)

  • Cryostorage system for cell line maintenance

  • Multi-channel pipetting systems for high-throughput assays

Protein Analysis Equipment:

  • Western blot apparatus and transfer systems

  • Protein purification systems (FPLC/HPLC)

  • Plate reader with fluorescence, luminescence, and absorbance detection

  • Flow cytometer for cell surface expression analysis

  • Confocal microscope for localization studies

  • SPR or BLI systems for binding kinetics

Specialized Reagents:

CategoryKey ReagentsApplication
Expression SystemsLemur-specific codon-optimized MC1R constructsOptimal expression
Expression vectors with various tags (His, FLAG, GFP)Purification and detection
Transfection reagents optimized for GPCRsEfficient delivery
Functional AssaysRecombinant α-MSHReceptor activation
cAMP detection kits (ELISA or HTRF-based)Signaling measurement
Phosphodiesterase inhibitors (IBMX)Prevent cAMP degradation
Calcium indicators (Fluo-4, Fura-2)Secondary signaling
AntibodiesAnti-MC1R antibodies (if available)Protein detection
Phospho-specific antibodies for downstream targetsSignaling pathway analysis
Species-appropriate secondary antibodiesDetection systems
ControlsRecombinant human MC1RComparative standard
Known MC1R antagonistsFunctional validation
Other melanocortin receptors (MC2R-MC5R)Specificity testing

Data Analysis Software:

  • Receptor pharmacology software (GraphPad Prism)

  • Protein structure visualization tools (PyMOL, Chimera)

  • Sequence analysis platforms (Geneious, MEGA)

  • Statistical analysis packages (R with specialized packages)

This comprehensive suite of equipment and reagents allows researchers to thoroughly characterize the biochemical, cellular, and pharmacological properties of Lemur catta MC1R, enabling meaningful comparative studies with other species and providing insights into the evolution of pigmentation systems in primates.

What are the most promising future directions for research on recombinant Lemur catta MC1R?

The study of recombinant Lemur catta MC1R offers several promising future research directions that could significantly advance our understanding of pigmentation biology, primate evolution, and adaptation mechanisms:

Evolutionary Genomics and Adaptation:
Future research should focus on comprehensive sampling across the geographic range of Lemur catta to characterize MC1R diversity in relation to habitat variables . Combining MC1R functional data with population genomics approaches will reveal how selection has shaped this locus during lemur evolution in Madagascar's diverse environments . The unique evolutionary history of lemurs, isolated on Madagascar for over 50 million years, provides an exceptional opportunity to study parallel and convergent evolution of pigmentation genetics compared to other primate lineages.

Functional Characterization of Receptor Signaling Networks:
Beyond basic activation studies, future research should investigate the complete signaling networks associated with MC1R in lemurs. This includes characterizing interactions with melanocortin ligands, antagonists like agouti signaling protein, and downstream effectors . Understanding these networks in a comparative context will reveal how signal transduction pathways evolve and adapt in different primate lineages. Advanced techniques such as CRISPR-mediated genome editing in cell models could help elucidate the functional consequences of MC1R variation in cellular contexts.

Integration with Environmental and Social Data:
The most promising direction involves integrating molecular and functional data with ecological and social variables. Ring-tailed lemurs live in complex social groups with distinctive patterns of male migration and female philopatry . Understanding how MC1R variation influences visual signals in this social context could reveal new insights into the role of pigmentation in primate communication and sexual selection. Additionally, investigating how MC1R variants correlate with environmental variables like UV exposure and predation pressure could illuminate adaptive mechanisms.

Translational Applications:
Comparative studies of MC1R across primates, including lemurs, have potential translational applications. Understanding how different primate lineages have evolved pigmentation mechanisms can provide insights into human conditions related to pigmentation disorders, UV sensitivity, and even melanoma susceptibility . The unique features of lemur MC1R may reveal novel functional properties with potential applications in biomedicine and dermatology.

Technological Innovations:
Future research should leverage emerging technologies, including:

  • Single-cell sequencing to understand MC1R expression patterns at unprecedented resolution

  • Long-read sequencing to characterize complete MC1R haplotypes and surrounding regulatory regions

  • Protein structure determination (cryo-EM) to visualize lemur MC1R in different activation states

  • Advanced functional genomics to map complete regulatory networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.