Recombinant Lemur catta Potassium voltage-gated channel subfamily S member 1 (KCNS1)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Classification

Recombinant Lemur catta Potassium voltage-gated channel subfamily S member 1 (KCNS1) is a laboratory-produced protein that replicates the structure and function of the naturally occurring KCNS1 protein found in ring-tailed lemurs. This protein belongs to the potassium voltage-gated channel subfamily S and is also known as "Delayed-rectifier K(+) channel alpha subunit 1" . As a member of the voltage-gated potassium channel family, it plays a crucial role in regulating membrane potential and cellular excitability.

Functional Significance

Potassium voltage-gated channels are integral membrane proteins that form selective pores through which potassium ions can pass across cellular membranes. These channels open in response to changes in membrane potential, allowing potassium ions to flow out of the cell, which typically results in hyperpolarization of the membrane. The KCNS1 protein specifically functions as a delayed-rectifier potassium channel, suggesting its involvement in the repolarization phase of action potentials in excitable cells such as neurons and muscle cells.

Taxonomic Classification and Habitat

Lemur catta, commonly known as the ring-tailed lemur, is a prosimian primate endemic to Madagascar. These primates are highly social and characterized by a strict female dominance hierarchy within their social groups . Understanding the biological context of the species provides important insights into the evolutionary and functional significance of their proteins, including KCNS1.

Behavioral and Physiological Characteristics

Ring-tailed lemurs exhibit diverse behavioral patterns influenced by both environmental and individual factors. While traditionally considered diurnal, studies have detected cathemeral activity (activity distributed throughout the 24-hour cycle) in some wild populations . Their adaptive capabilities allow them to thrive both in arboreal and terrestrial environments, spending up to 33% of their day on the ground . These behavioral adaptations may influence neurophysiological functions mediated by proteins like KCNS1.

Protein Structure and Domains

While specific structural details of Lemur catta KCNS1 are not extensively documented in the literature, it likely shares common structural elements with other voltage-gated potassium channels. These typically include six transmembrane segments (S1-S6) with the S4 segment serving as the voltage sensor, and a pore-forming region between S5 and S6 that confers potassium selectivity. The recombinant protein is available in both full-length and partial formats depending on research requirements .

Sequence Conservation and Evolutionary Implications

The KCNS1 gene is conserved across various mammalian species, including primates and rodents. Comparative analysis of KCNS1 across species can provide insights into evolutionary conservation and functional importance of specific domains. The availability of recombinant KCNS1 from multiple species, including Lemur catta, facilitates such comparative studies .

Expression Systems and Their Applications

Recombinant Lemur catta KCNS1 can be produced using various expression systems, each offering distinct advantages:

  1. E. coli expression systems provide high protein yields at relatively low cost, though they may struggle with proper folding of complex membrane proteins like ion channels.

  2. Yeast-based expression offers eukaryotic post-translational modifications while maintaining relatively high yields.

  3. Baculovirus-infected insect cells provide more complex eukaryotic machinery for protein production.

  4. Mammalian cell expression systems most closely mimic the natural cellular environment for primate proteins.

  5. Cell-free expression systems offer rapid production without cellular constraints .

Purification and Quality Assessment

According to product specifications, recombinant Lemur catta KCNS1 proteins are purified to greater than or equal to 85% purity as determined by SDS-PAGE . This level of purity ensures consistent performance in downstream applications including functional assays, antibody production, and structural studies. Quality control measures for these recombinant proteins include gel electrophoresis to confirm molecular weight and purity.

Functional Characterization Studies

Recombinant KCNS1 serves as a valuable tool for electrophysiological studies examining channel function, activation/inactivation kinetics, and response to modulators. Using techniques such as patch-clamp electrophysiology, researchers can investigate the biophysical properties of Lemur catta KCNS1 and compare them with orthologous channels from other species.

Comparative Physiology and Evolutionary Studies

The availability of recombinant KCNS1 from various primate species, including Lemur catta, Rhesus macaque (Macaca mulatta), and human, enables comparative studies to investigate evolutionary conservation and species-specific adaptations in potassium channel function . Such studies can reveal how evolutionary pressures have shaped ion channel properties across primate lineages.

Cross-Species KCNS1 Comparison

Table 1 presents a comparative analysis of KCNS1 proteins available as recombinant products from different species, highlighting their similarities and differences.

SpeciesScientific NameAlternative NamesHost Expression Options
Ring-tailed lemurLemur cattaDelayed-rectifier K(+) channel alpha subunit 1E. coli, Yeast, Baculovirus, Mammalian cells, Cell-free expression
Rhesus macaqueMacaca mulattaPotassium voltage-gated channel subfamily S member 1E. coli, Yeast, Baculovirus, Mammalian cells, Cell-free expression
HumanHomo sapiensKv9.1, Potassium voltage-gated channel modifier subfamily S member 1Cell-free expression
RatRattus norvegicusKcns1, Kv9.1E. coli, Yeast, Baculovirus, Mammalian cells, Cell-free expression
MouseMus musculusKcns1, Kv9.1Cell-free expression

Functional Conservation and Divergence

While the core functions of potassium channels are likely conserved across species, subtle variations in amino acid sequences may lead to differences in biophysical properties, regulation mechanisms, and pharmacological responses. These differences may reflect adaptations to species-specific physiological requirements and environmental conditions.

Biochemical Properties

Table 2 summarizes the key biochemical properties of Recombinant Lemur catta KCNS1 based on available product information.

PropertyDescriptionReference
Protein NamePotassium voltage-gated channel subfamily S member 1
Alternative NamesDelayed-rectifier K(+) channel alpha subunit 1
Gene SymbolKCNS1
Available FormatsFull-length and partial constructs
Purity≥85% as determined by SDS-PAGE
Expression OptionsE. coli, Yeast, Baculovirus, Mammalian cells, Cell-free systems

Expression System Comparison

Table 3 compares the different expression systems used for producing Recombinant Lemur catta KCNS1, highlighting their relative advantages and limitations.

Expression SystemAdvantagesLimitationsOptimal Applications
E. coliHigh yield, Cost-effective, Rapid productionLimited post-translational modificationsAntibody production, Structural studies
YeastEukaryotic post-translational modificationsMore complex than bacterial systemsFunctional studies requiring glycosylation
Baculovirus/Insect cellsComplex eukaryotic modifications, Good for membrane proteinsModerate yield, Higher costStructural and functional studies
Mammalian cellsNative-like modifications, Proper foldingLower yield, Highest costDrug screening, Physiological studies
Cell-free expressionRapid production, No cellular constraintsVariable yield, Limited modificationsPreliminary screening, Quick analysis

Potential Applications in Neuroscience

Future research on Recombinant Lemur catta KCNS1 may focus on its role in neuronal excitability, synaptic transmission, and potential implications for understanding neurological disorders. Comparative studies between lemur KCNS1 and human KCNS1 could provide insights into the evolution of neurophysiological mechanisms and potentially identify novel therapeutic targets.

Technological Advances and Methodological Improvements

Advances in structural biology techniques, including cryo-electron microscopy and X-ray crystallography, may enable determination of the three-dimensional structure of Lemur catta KCNS1 at atomic resolution. Integration with systems biology approaches could further elucidate the role of this protein within broader signaling networks and physiological processes.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Please note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize the development of your specified tag.
Synonyms
KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-529
Protein Length
full length protein
Species
Lemur catta (Ring-tailed lemur)
Target Names
KCNS1
Target Protein Sequence
MLMLLVRGTHFENNWSKLIPPAPLDATVSEPPVPDSGEPDSGVPWRRSDEALRVNVGGVR RRLSARALARFPGTRLGRLQAAKSEEQARRLCDDYDAAAREFYFDRHPGFFLSLLHFYRT GRLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRVARPRAWDEDSDTPSSVDPN PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSIGVVLASIAAMCIH SLPEYQAREAAAAVATVAAGRSAEDVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLASVALGGNNHGGTSGEELGHLGKVVQVFRLMRIFRVLKL ARHSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFDTIPACWWWG TVSMTTVGYGDVVPVTLAGKLAASGCILGGILVVALPITIIFNKFSHFYQRQKALEAAVR NSGHREFEDLLSSVDGVSDASLETSRETSQEGRSADLEAPSESPKPQIY
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It can form functional heterotetrameric channels with KCNB1 and KCNB2, modulating the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Protein Families
Potassium channel family, S (TC 1.A.1.2) subfamily, Kv9.1/KCNS1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of KCNS1 in Lemur catta?

KCNS1 in Lemur catta is a 529 amino acid protein functioning as a delayed-rectifier K(+) channel alpha subunit . The full amino acid sequence begins with mLmLLVRGTHFENNWSK and continues through a series of functional domains . Structurally, KCNS1 belongs to the electrically silent voltage-gated potassium channel (KvS) subfamily, which cannot form functional homotetramers independently .

Unlike some potassium channels, KCNS1 requires heteromerization with members of the Kcnb (Kv2) superfamily to become functionally active. This association stabilizes the resultant currents and promotes closed-state inactivation that attenuates excitability . Methodologically, to study this heteromerization, researchers typically employ co-expression systems where KCNS1 and Kcnb members are simultaneously expressed in heterologous cells, followed by electrophysiological recordings to assess channel properties.

How does KCNS1 expression in Lemur catta compare with other primates?

KCNS1 expression patterns show both conservation and divergence across primate species. Comparative genomic analyses reveal that KCNS1 is part of a 130-kb region with a notably complex evolutionary history including nested duplications, deletions, and significant interspecies divergence .

When examining expression across different primates, methodological approaches typically include:

  • RT-qPCR to quantify relative expression levels

  • In situ hybridization to visualize tissue-specific expression patterns

  • Western blot analyses using custom antibodies (such as the rabbit anti-KCNS1 antibody at 1 μg/μL concentration)

The KCNS1 gene in prosimians like Lemur catta provides important insights about the ancestral architecture of potassium channel gene clusters. In evolutionary studies comparing primates, lemurs and galagos have shown distinct patterns in their SEMG-related sequences that are located near KCNS1, suggesting evolutionary pressures on this genomic region .

What are the optimal methods for expressing and purifying recombinant Lemur catta KCNS1?

Expression and purification of recombinant Lemur catta KCNS1 can be achieved through multiple expression systems with varying efficiency:

Expression Systems:

  • E. coli

  • Yeast

  • Baculovirus

  • Mammalian cell expression systems

The choice of expression system depends on research needs. For structural studies requiring high protein yields, bacterial or yeast systems may be preferable. For functional studies requiring proper post-translational modifications, mammalian cell expression is recommended.

Purification Protocol:

  • Express with appropriate tags (determined during production process)

  • Lyse cells in Tris-based buffer with protease inhibitors

  • Purify using affinity chromatography

  • Verify purity by SDS-PAGE (minimum acceptable purity: ≥85%)

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

For working with purified protein, it's recommended to avoid repeated freezing and thawing, and working aliquots should be stored at 4°C for no more than one week .

What cellular localization patterns are observed for KCNS1 in neural tissues?

KCNS1 shows distinct subcellular localization patterns that correlate with its functional roles:

In rodent studies, KCNS1 is predominantly expressed in:

  • Cell bodies and axons of myelinated sensory neurons positive for neurofilament-200

  • Aδ-fiber nociceptors and low-threshold Aβ mechanoreceptors

  • Laminae III to V of the dorsal horn in the spinal cord (where most sensory A fibers terminate)

  • Large motoneurons of the ventral horn

Methodologically, cellular localization is typically determined using:

  • Immunohistochemistry with specific anti-KCNS1 antibodies

  • Fluorescence microscopy with digital image acquisition

  • Quantification of immunoreactivity using software like ImageJ

  • Objective criteria for positive staining (e.g., signal intensity > 2×background + 2×SEM)

Understanding KCNS1 cellular distribution helps elucidate its role in sensory processing and pain modulation.

How do polymorphisms in KCNS1 contribute to pain sensitivity variation in primates?

KCNS1 polymorphisms significantly influence pain sensitivity through modulation of sensory neuron excitability. Research in humans has shown that common amino acid-altering KCNS1 polymorphisms associate with pain phenotypes across multiple independent cohorts .

Methodological approaches to study this relationship include:

  • Genetic Association Studies:

    • Genotyping of SNP panels spanning the KCNS1 gene region

    • Association analysis with pain phenotypes in clinical cohorts

    • Haplotype analysis to identify risk variants

  • Functional Validation:

    • Site-directed mutagenesis to recreate polymorphisms

    • Patch-clamp electrophysiology to assess channel function

    • Calcium imaging to evaluate neuronal excitability

  • Translational Models:

    • Generation of knock-in mice expressing human KCNS1 variants

    • Behavioral assessment of pain sensitivity using mechanical, thermal, and cold stimuli

    • Correlation of sensory neuron activity with pain behaviors

In knockout studies, mice lacking KCNS1 in peripheral neurons display exaggerated mechanical pain responses and hypersensitivity to both noxious and innocuous cold, consistent with increased A-fiber activity . This suggests that KCNS1 activity is pain protective, and understanding polymorphisms could lead to personalized pain management strategies.

What methodological approaches are most effective for studying KCNS1 function in vivo?

Several complementary methodological approaches have proven effective for investigating KCNS1 function in vivo:

  • Conditional Gene Deletion:

    • Cre-loxP system for tissue-specific deletion

    • Tamoxifen-inducible deletion for temporal control

    • Adeno-associated virus (AAV) delivery of Cre recombinase

  • Behavioral Phenotyping:

    • von Frey testing for mechanical sensitivity

    • Hargreaves test for heat sensitivity

    • Acetone test for cold sensitivity

    • Rotarod test for motor coordination (useful for assessing proprioceptive effects)

  • Electrophysiological Assessment:

    • Ex vivo skin-nerve preparations to record from sensory fibers

    • In vivo extracellular recordings from dorsal horn neurons

    • Patch-clamp recordings from identified DRG neurons

  • Molecular Analysis:

    • Quantitative RT-PCR for expression analysis

    • Western blotting for protein levels

    • Immunohistochemistry with specific antibodies (applying strict criteria: signal intensity > 2×background + 2×SEM)

  • Network Analysis:

    • Unbiased network analysis of expression profiles to identify co-regulated genes

    • Identification of nearest co-associated neighbors (as was done with KCNS1, revealing 83% neuronal expression and 79% involvement in membrane signaling)

These approaches collectively provide robust assessment of KCNS1 function in sensory processing, pain, and related phenotypes.

How does heteromerization of KCNS1 with Kcnb family members affect channel properties?

KCNS1 belongs to the electrically silent voltage-gated potassium channel (KvS) subfamily and cannot form functional homotetramers on its own. Its function critically depends on heteromerization with members of the Kcnb (Kv2) superfamily :

Methodological approaches to study heteromerization:

  • Co-immunoprecipitation:

    • Express tagged versions of KCNS1 and Kcnb subunits

    • Immunoprecipitate one subunit and detect the other

    • Quantify interaction strength under varying conditions

  • Electrophysiology:

    • Heterologous expression systems (HEK293 cells)

    • Patch-clamp recordings to measure:

      • Voltage-dependence of activation and inactivation

      • Kinetics of activation and deactivation

      • Current amplitude and density

  • Computational Modeling:

    • Simulations indicating that KCNS1 association with Kcnb members can:

      • Stabilize resultant currents

      • Promote closed-state inactivation

      • Attenuate excitability

  • Ex vivo Recordings:

    • Demonstrate that Kcnb/KCNS1 signaling in sensory neurons is compromised after nerve injury

The functional consequences of KCNS1-Kcnb heteromerization include modified channel kinetics, altered voltage sensitivity, and ultimately decreased neuronal excitability, which contributes to KCNS1's pain-protective role.

What is the role of KCNS1 in temporal lobe epilepsy and potential therapeutic approaches?

KCNS1 has been identified as one of four key TLE-related potassium channel genes (TERKPCGs) through bioinformatic analysis of temporal lobe epilepsy (TLE) samples . Understanding its role offers potential therapeutic insights:

Methodological approaches to studying KCNS1 in epilepsy:

  • Transcriptomic Analysis:

    • Weighted Gene Co-expression Network Analysis (WGCNA) to identify modules associated with TLE

    • Differential expression analysis between normal and TLE samples

  • Functional Enrichment Analysis:

    • Gene Set Enrichment Analysis (GSEA) showing KCNS1 is most closely related to potassium channel complex function

    • GO term analysis revealing associations with ion channel complexes and voltage-gated channel activity

  • Regulatory Network Analysis:

    • Identification of transcription factors regulating KCNS1 (including TFAP4, FOXM1, POSTN, and PTEN)

    • miRNA prediction revealing six miRNAs targeting KCNS1

    • Construction of competing endogenous RNA (ceRNA) networks

  • Therapeutic Approaches:

    • Gene therapy to restore KCNS1 function in epileptic tissue

    • Compounds enhancing KCNS1 activity as potential analgesics

    • Small molecule modulators that can enhance KCNS1-Kcnb heteromer function

The downregulation of KCNS1 in TLE cases suggests that restoring its function might provide a novel therapeutic strategy, similar to how upregulation of the related KCNA1 has successfully suppressed seizures in rodent models of intractable TLE .

How does the function of KCNS1 differ between Lemur catta and other mammalian species?

Comparative functional analysis of KCNS1 across species provides evolutionary insights:

Methodological approaches for cross-species comparison:

  • Sequence Analysis:

    • Alignment of KCNS1 protein sequences from Lemur catta, other primates, and non-primate mammals

    • Identification of conserved domains and species-specific variations

    • Analysis of selection pressures using dN/dS ratios

  • Expression Pattern Comparison:

    • In situ hybridization across species

    • Immunohistochemistry using cross-reactive antibodies

    • RT-qPCR with species-specific primers

  • Functional Characterization:

    • Heterologous expression of KCNS1 from different species

    • Patch-clamp recording to compare electrophysiological properties

    • Assessment of heteromerization efficiency with conserved Kcnb family members

  • Evolutionary Context:

    • In prosimians like Lemur catta, KCNS1 exists in a genomic region showing complex evolutionary history

    • The 130-kb region containing KCNS1 has undergone nested duplications, deletions, and significant interspecies divergence

    • This has led to striking differences in this region among primates and between primates and rodents

These approaches reveal that while KCNS1's core functions appear conserved across mammals, species-specific variations likely reflect adaptations to different sensory processing needs and environmental pressures.

What are the challenges in developing selective KCNS1 modulators for pain management?

Developing selective KCNS1 modulators presents several challenges that require sophisticated research approaches:

Methodological challenges and solutions:

  • Target Specificity:

    • Challenge: High conservation among potassium channel family members

    • Approach: High-throughput screening against KCNS1-Kcnb heteromers versus other K+ channels

    • Method: Fluorescence-based membrane potential assays in cell lines expressing defined channel compositions

  • Functional Dependency:

    • Challenge: KCNS1 requires heteromerization with Kcnb members to function

    • Approach: Target the KCNS1-Kcnb interface or allosteric sites specific to heteromers

    • Method: Structural biology combined with computational modeling to identify unique binding pockets

  • Pharmacological Limitations:

    • Challenge: "Further dissecting the role of KCNS1 is hampered by the lack of pharmacological tools to specifically target this member within the highly conserved Kv family"

    • Approach: Development of monoclonal antibodies or aptamers with higher specificity than small molecules

    • Method: Phage display or SELEX to identify highly selective binding moieties

  • Therapeutic Index:

    • Challenge: KCNS1 expression in multiple tissues including cardiac tissue

    • Approach: Local delivery to peripheral sensory neurons or use of tissue-penetrant compounds

    • Method: Development of prodrugs activated by neuron-specific enzymes

  • Translational Gap:

    • Challenge: Species differences in drug sensitivity

    • Approach: Use of humanized mouse models or human iPSC-derived sensory neurons

    • Method: CRISPR/Cas9 gene editing to create physiologically relevant test systems

Despite these challenges, enhancing KCNS1 function represents a promising approach for pain management, as "restoring KCNS1 function in the periphery may be of some use in ameliorating mechanical and cold pain in chronic states" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.