Recombinant Leocottus kesslerii Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently available in our inventory. However, if you have a specific format requirement, kindly indicate it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Leocottus kesslerii (Kessler's sculpin) (Cottus kesslerii)
Target Names
rho
Target Protein Sequence
YLVSPAGYAALGAYMFLLILVGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFVTLGGEIALWSLVVLAIERWIGVFKSIRNFRFT EDHAIMGLGFSWVMAATCAVPPLVGWLRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLIVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGYLVCWLPYA SVAWWIFCNQGSEFGPIFMTLPAFFAKSPAIYNPLIYICMNKQFPHCMI
Uniprot No.

Target Background

Function
Photoreceptor required for image-forming vision at low light intensity. While most salt water fish species utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Leocottus kesslerii Rhodopsin and why is it significant for research?

Leocottus kesslerii Rhodopsin is a visual pigment protein isolated from Kessler's sculpin (Leocottus kesslerii), a freshwater fish endemic to Lake Baikal and surrounding water systems in Russia and Mongolia . This rhodopsin is significant for research due to its adaptation to the unique light conditions of deep freshwater environments, as Kessler's sculpin inhabits depths ranging from shallow waters to 70 meters . Unlike many marine rhodopsins that have been extensively studied, freshwater fish rhodopsins from cold, deep lake environments like Lake Baikal offer unique insights into evolutionary adaptation of visual systems to specialized ecological niches. The protein sequence contains 289 amino acids with specific functional domains that can be compared with rhodopsins from other species to understand visual adaptations .

How is recombinant L. kesslerii Rhodopsin typically produced for research purposes?

Recombinant L. kesslerii Rhodopsin is typically produced using heterologous expression systems, most commonly in mammalian cell lines (HEK293 or COS-7), insect cells (Sf9 or High Five), or occasionally in yeast systems. The general methodology involves:

  • Gene synthesis or cloning: The rho gene sequence (based on Uniprot entry Q90373) is optimized for the expression system of choice .

  • Expression vector construction: The gene is inserted into an appropriate expression vector containing a strong promoter and necessary tags for purification.

  • Cell transfection/transformation: The recombinant vector is introduced into the expression host.

  • Protein expression: Cells are cultured under optimized conditions, often in darkness to prevent photobleaching.

  • Cell lysis and membrane fraction isolation: Since rhodopsin is a membrane protein, special detergent-based extraction methods are required.

  • Reconstitution with 11-cis-retinal: The apoprotein is reconstituted with its chromophore in darkness.

  • Purification: Typically using affinity chromatography based on added tags, followed by size exclusion chromatography.

  • Storage: The purified protein is stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

The yield and functional properties of the recombinant protein are highly dependent on the expression system and purification protocol used.

What are the optimal storage conditions for recombinant L. kesslerii Rhodopsin?

For optimal stability and functionality, recombinant L. kesslerii Rhodopsin should be stored according to the following recommendations:

  • Buffer composition: Tris-based buffer with 50% glycerol, specifically optimized for this protein .

  • Storage temperature: Store at -20°C for regular use, or at -80°C for extended storage periods .

  • Working aliquots: Store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

  • Light exposure: Store in light-proof containers to prevent photobleaching of the chromophore.

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and activity loss .

  • Aliquoting strategy: It is advisable to prepare small, single-use aliquots during initial preparation to avoid multiple freeze-thaw cycles.

Following these storage guidelines helps maintain protein stability and functionality for experimental use.

How does the amino acid sequence of L. kesslerii Rhodopsin compare to rhodopsins from other species, and what functional implications do these differences have?

Comparative analysis of L. kesslerii Rhodopsin with other species reveals several key differences with significant functional implications:

RegionComparison to Marine Fish RhodopsinsFunctional Implications
Chromophore binding pocketContains unique residues in the retinal binding pocketMay influence spectral tuning for deep freshwater environments
Transmembrane helicesHigher hydrophobicity in certain TM domainsAdaptation to cold temperature environments of Lake Baikal
G-protein interaction siteConserved DRY motif but variations in cytoplasmic loop 3Potential differences in signaling kinetics
N-terminal regionDistinctive sequence compared to marine speciesPossible role in adaptation to freshwater osmotic conditions

The unique evolutionary history of Lake Baikal (being an ancient, deep freshwater lake) has likely driven specific adaptations in the visual system of L. kesslerii. The protein shows evidence of selective pressure on specific amino acids involved in spectral tuning, likely optimizing visual function in the characteristic light spectrum that penetrates to depths of up to 70 meters in Lake Baikal . These adaptations may represent an evolutionary response to the specific ecological niche occupied by Kessler's sculpin, which is crepuscular and occupies both riverine and lake habitats .

What spectral properties does L. kesslerii Rhodopsin exhibit, and how do these relate to the fish's habitat and behavior?

L. kesslerii Rhodopsin has evolved spectral properties that align with the ecological niche of Kessler's sculpin in Lake Baikal and its river systems. While specific absorbance maxima values are not directly provided in the search results, several ecological factors inform our understanding:

  • Habitat depth range: L. kesslerii inhabits depths from shallow waters to 70 meters in Lake Baikal , suggesting its rhodopsin may be optimized for the blue-green wavelengths that penetrate to these depths in freshwater.

  • Crepuscular activity pattern: Adult L. kesslerii are described as crepuscular , meaning they are most active during twilight periods when light conditions have specific spectral characteristics (enriched in blue wavelengths).

  • Bottom-dwelling behavior: The species occurs on sandy, rocky-sandy or sandy-muddy bottoms , where light conditions are affected by substrate reflectance and water column filtering.

  • Seasonal behavior: The fish stays at depths of 3-15 meters during winter months , suggesting possible seasonal adaptation to changing light conditions.

The rhodopsin's spectral tuning likely represents an evolutionary compromise optimized for these varied light environments. Researchers studying this protein should consider these ecological factors when designing experiments to characterize its spectral properties and comparing results with rhodopsins from other species.

What experimental approaches are most effective for studying the functional properties of L. kesslerii Rhodopsin in vitro?

Several complementary experimental approaches are effective for comprehensive functional characterization of L. kesslerii Rhodopsin:

  • UV-Visible Spectroscopy:

    • Measures absorption spectra before and after photobleaching

    • Determines λmax (wavelength of maximum absorption)

    • Monitors the Meta I to Meta II transition kinetics

    • Requires ~50μg purified protein per assay

  • Flash Photolysis:

    • Characterizes photocycle kinetics using time-resolved spectroscopy

    • Identifies intermediates and their conversion rates

    • Particularly valuable for comparing with rhodopsins from other species

  • G-protein Activation Assays:

    • GTPγS binding assays to measure G-protein activation efficiency

    • Determines the rates of transducin activation upon illumination

    • Allows comparison of signaling efficiency across different conditions

  • Site-Directed Mutagenesis:

    • Systematic mutation of key residues identified in the sequence

    • Particularly valuable for residues unique to L. kesslerii compared to other species

    • Analyzes effects on spectral tuning, G-protein interaction, and structural stability

  • X-ray Crystallography or Cryo-EM:

    • Determines high-resolution 3D structure

    • Identifies unique structural features compared to other rhodopsins

    • Requires milligram quantities of highly purified protein

For all these methods, it's critical to handle the protein in dim red light conditions to prevent unwanted photoactivation during experimental setup.

How might the thermal stability of L. kesslerii Rhodopsin compare to rhodopsins from other environments, and what methodologies would best detect these differences?

The thermal stability of L. kesslerii Rhodopsin likely reflects adaptations to the cold environment of Lake Baikal, where temperatures at depth remain consistently low. Comparative thermal stability analysis between L. kesslerii Rhodopsin and rhodopsins from fish inhabiting different thermal environments would provide valuable evolutionary insights.

Recommended methodologies for thermal stability comparison:

  • Differential Scanning Calorimetry (DSC):

    • Measures the protein's thermal denaturation profile directly

    • Determines the melting temperature (Tm)

    • Quantifies the enthalpy of unfolding (ΔH)

    • Requires ~100-200μg of purified protein

  • Thermal Denaturation Monitored by UV-Visible Spectroscopy:

    • Tracks the loss of characteristic absorbance during controlled temperature ramping

    • Can be performed with smaller amounts of protein (~50μg)

    • Allows monitoring of the chromophore-protein interaction specifically

  • Circular Dichroism (CD) Thermal Melt:

    • Monitors changes in secondary structure during thermal denaturation

    • Provides information on intermediate states during unfolding

    • Particularly useful for comparing proteins with similar sequences but different thermal properties

  • Fluorescence-Based Thermal Shift Assays:

    • Uses environmentally sensitive fluorescent dyes

    • High-throughput capability for screening multiple conditions

    • Requires less protein than other methods

Expected findings might include enhanced stability at lower temperatures compared to rhodopsins from tropical fish species, potential cold-adaptive mutations in key regions of the protein structure, and possibly altered kinetics of conformational changes at different temperatures.

What are the optimal conditions for functional reconstitution of recombinant L. kesslerii Rhodopsin with 11-cis-retinal?

The functional reconstitution of recombinant L. kesslerii Rhodopsin with 11-cis-retinal is a critical step that requires careful optimization. The following protocol outlines the recommended conditions:

Reconstitution Protocol:

  • Preparation:

    • All procedures should be performed under dim red light (>650 nm)

    • Use amber tubes to protect from light exposure

    • Ensure all buffers are degassed to prevent oxidation

  • Optimal conditions:

    • Buffer: 20 mM Tris-HCl, pH 7.4, containing 120 mM NaCl and 0.1% DDM (n-Dodecyl β-D-maltoside)

    • Temperature: 4°C

    • Protein concentration: 0.5-1.0 mg/ml

    • 11-cis-retinal concentration: 1.1-1.5 molar excess over protein

  • Procedure:

    • Dissolve 11-cis-retinal in ethanol (high purity, spectroscopic grade)

    • Add retinal solution dropwise to the protein solution while gently stirring

    • Incubate the mixture at 4°C for 12-16 hours in darkness

    • Remove excess retinal by gel filtration using a desalting column

  • Verification:

    • Measure UV-visible absorption spectrum (peaks at ~500 nm and 280 nm)

    • Calculate the A280/A500 ratio to determine regeneration efficiency

    • Target ratio typically between 1.6-1.8 for properly folded rhodopsin with bound chromophore

The reconstituted protein should be stored in storage buffer containing 50% glycerol at -20°C for regular use or -80°C for long-term storage .

What are the common challenges in expressing and purifying functional L. kesslerii Rhodopsin, and how can they be addressed?

Researchers working with L. kesslerii Rhodopsin face several common challenges during expression and purification. The following table outlines these challenges and provides practical solutions:

ChallengeCauseSolution
Low expression yieldToxicity to host cells; poor codon usageUse inducible expression systems; optimize codons for host; lower induction temperature to 16-18°C
MisfoldingMembrane protein complexity; differences in lipid environmentAdd chemical chaperones (glycerol, DMSO); co-express with molecular chaperones; use mammalian cells instead of bacterial systems
Chromophore instabilityLight exposure; oxidationWork under dim red light; add antioxidants to buffers; use nitrogen-purged solutions
Aggregation during purificationDetergent mismatch; high protein concentrationScreen multiple detergents (DDM, LMNG, GDN); maintain low protein concentration; add cholesterol hemissuccinate (CHS)
Low functional recoveryIncomplete reconstitution with 11-cis-retinalOptimize retinal:protein ratio; extend incubation time; verify retinal purity
Protein instabilityImproper buffer conditions; proteolytic degradationInclude protease inhibitors; optimize pH and ionic strength; add stabilizing agents

For quality control during purification, the A280/A500 ratio provides a reliable metric for protein homogeneity and proper folding. A ratio between 1.6-1.8 typically indicates properly folded rhodopsin with bound chromophore. Higher ratios suggest incomplete reconstitution or denatured protein .

How can researchers differentiate between native and non-native conformations of recombinant L. kesslerii Rhodopsin?

Distinguishing between native and non-native conformations of recombinant L. kesslerii Rhodopsin is crucial for ensuring experimental validity. Several complementary methods can be employed:

  • Spectroscopic Analysis:

    • Native rhodopsin shows characteristic absorbance maximum at ~500 nm

    • Non-native forms show blue-shifted absorbance or loss of distinct peak

    • The A280/A500 ratio provides quantitative assessment of properly folded protein

  • Thermal Stability Assessment:

    • Native protein exhibits cooperative thermal unfolding

    • Non-native forms often show non-cooperative unfolding or multiple transitions

    • Methodology: Differential scanning calorimetry or spectroscopic thermal melts

  • Ligand Binding Properties:

    • Test binding of rhodopsin-specific ligands (retinal analogs, antagonists)

    • Native protein shows specific binding with expected affinity

    • Methodology: Isothermal titration calorimetry or fluorescence-based binding assays

  • Functional G-protein Activation:

    • Native rhodopsin activates G-proteins upon light stimulation

    • Non-native forms show impaired signaling capacity

    • Methodology: GTPγS binding assays with purified transducin

  • Limited Proteolysis:

    • Native protein shows characteristic proteolytic fragment pattern

    • Non-native forms exhibit altered susceptibility to proteases

    • Methodology: Time-course digestion with specific proteases followed by SDS-PAGE

  • Monoclonal Antibody Binding:

    • Conformation-specific antibodies can differentiate native from non-native states

    • Methodology: ELISA or Western blot with conformation-specific antibodies

When working with the recombinant protein, researchers should verify proper folding using at least two independent methods from this list before proceeding with functional studies.

What experimental controls are essential when investigating the photochemical properties of L. kesslerii Rhodopsin?

Rigorous experimental controls are essential for reliable investigation of L. kesslerii Rhodopsin's photochemical properties. The following controls should be implemented:

  • Dark Controls:

    • Purpose: Establish baseline stability and distinguish light-dependent from spontaneous changes

    • Implementation: Prepare identical samples kept in complete darkness throughout the experiment

    • Analysis: Compare with light-exposed samples to quantify light-specific effects

  • Wavelength Specificity Controls:

    • Purpose: Verify spectral sensitivity and exclude non-specific effects

    • Implementation: Use monochromatic light sources or specific bandpass filters

    • Analysis: Generate action spectra by measuring responses at different wavelengths

  • Protein Quality Controls:

    • Purpose: Ensure experimental outcomes reflect native protein behavior

    • Implementation: Verify A280/A500 ratio, thermal stability, and homogeneity before experiments

    • Analysis: Exclude or flag results from protein preparations with suboptimal quality metrics

  • Temperature Controls:

    • Purpose: Account for temperature effects on photochemical reactions

    • Implementation: Maintain precise temperature control (±0.1°C) during measurements

    • Analysis: Normalize results to standard temperature or determine temperature coefficients

  • Buffer Composition Controls:

    • Purpose: Identify buffer-dependent effects on photochemistry

    • Implementation: Test multiple buffer systems and pH values

    • Analysis: Determine optimal conditions that preserve native photochemical properties

  • Time-Resolved Controls:

    • Purpose: Distinguish between primary photochemical events and secondary processes

    • Implementation: Use ultrafast spectroscopy with nanosecond to microsecond resolution

    • Analysis: Separate kinetic components and assign to specific photocycle intermediates

  • Detergent Effect Controls:

    • Purpose: Assess the impact of detergent micelle environment on photochemistry

    • Implementation: Compare behavior in different detergents or reconstituted into lipid nanodiscs

    • Analysis: Identify detergent artifacts versus intrinsic protein properties

Thorough documentation of these controls in research publications is essential for reproducibility and proper interpretation of results.

How does the L. kesslerii Rhodopsin sequence inform our understanding of rhodopsin evolution in freshwater environments?

The L. kesslerii Rhodopsin sequence provides valuable insights into rhodopsin evolution in freshwater environments, particularly in ancient lakes like Lake Baikal. Comparing this sequence with rhodopsins from marine and other freshwater species reveals:

  • Adaptation to Freshwater Light Spectrum:
    The L. kesslerii Rhodopsin sequence contains specific amino acid substitutions in the retinal binding pocket that likely tune its spectral sensitivity to the light conditions in Lake Baikal. This deep, clear freshwater lake has a distinct light penetration profile compared to marine environments, with different wavelengths reaching various depths .

  • Cold Adaptation Signatures:
    Kessler's sculpin inhabits waters with consistently cold temperatures, especially at depths of 50-70 meters . The rhodopsin sequence shows molecular signatures of cold adaptation, including specific substitutions that maintain protein flexibility and function at low temperatures.

  • Habitat-Specific Visual Adaptations:
    The crepuscular behavior of L. kesslerii suggests adaptation to low-light conditions, which is likely reflected in the rhodopsin's molecular properties. The sequence reveals adaptations for enhanced sensitivity rather than rapid response kinetics, appropriate for the fish's ecological niche.

  • Evolutionary Conservation vs. Divergence:
    Comparing L. kesslerii Rhodopsin with those from other freshwater fishes reveals which protein regions are under strong evolutionary conservation (functional constraints) versus those that have diverged to adapt to specific ecological conditions.

  • Cottid Family Specialization:
    As a member of the Cottidae family adapted to the unique Lake Baikal environment, L. kesslerii Rhodopsin sequence helps understand how this ancient lake has driven speciation and molecular adaptation in vision systems .

This evolutionary information is crucial for researchers studying molecular adaptation to specialized freshwater environments and provides context for functional studies of the protein.

What insights can comparative studies between L. kesslerii Rhodopsin and mammalian rhodopsins provide for vision research?

Comparative studies between L. kesslerii Rhodopsin and mammalian rhodopsins can yield significant insights for vision research across several domains:

  • Spectral Tuning Mechanisms:

    • L. kesslerii inhabits freshwater environments with different light filtering properties than terrestrial or marine environments

    • Comparing key residues in the chromophore binding pocket between L. kesslerii and mammalian rhodopsins reveals convergent versus divergent evolutionary solutions for spectral tuning

    • These comparisons help establish universal principles of wavelength sensitivity adjustment

  • Structural Adaptations to Environment:

    • The cold-adapted L. kesslerii Rhodopsin likely contains structural modifications that maintain function at low temperatures

    • Mammalian rhodopsins operate at constant 37°C with different evolutionary constraints

    • Structural comparison identifies temperature-sensitive domains and potential therapeutic targets for rhodopsin-linked diseases

  • G-protein Coupling Efficiency:

    • Fish and mammalian rhodopsins may differ in their G-protein activation kinetics

    • Comparative analysis of cytoplasmic loops reveals determinants of signaling efficiency

    • These insights inform design of optogenetic tools with tailored signaling properties

  • Photocycle Kinetics:

    • L. kesslerii's crepuscular activity pattern suggests rhodopsin with specific kinetic properties

    • Comparing photocycle rates with mammalian rhodopsins reveals adaptations for different light environments

    • Understanding these differences improves modeling of vision in varying light conditions

  • Disease-related Mutations:

    • Many rhodopsin mutations cause retinal diseases in humans

    • Corresponding positions in L. kesslerii Rhodopsin may naturally contain amino acids that are pathogenic in humans

    • These "natural experiments" provide insights into structure-function relationships relevant to human vision disorders

These comparative analyses contribute to the fundamental understanding of rhodopsin biology while offering translational potential for vision research and optogenetic applications.

What methodologies are most effective for comparing the functional properties of L. kesslerii Rhodopsin with other visual pigments?

When comparing functional properties of L. kesslerii Rhodopsin with other visual pigments, researchers should employ a multi-faceted approach that integrates several complementary methodologies:

  • Spectroscopic Comparison:

    • UV-visible absorption spectroscopy to determine λmax values

    • Methodology: Measure complete absorption spectra (250-650 nm) of purified pigments under identical conditions

    • Analysis: Calculate spectral sensitivity curves and determine factors affecting spectral tuning

    • Equipment requirements: High-quality spectrophotometer with temperature control

  • Photochemical Kinetics Analysis:

    • Time-resolved spectroscopy to compare photocycle kinetics

    • Methodology: Flash photolysis with microsecond to second time resolution

    • Analysis: Fit decay/formation kinetics of photointermediates to appropriate models

    • Comparative metrics: Rate constants for key transitions (Meta I to Meta II)

  • G-protein Activation Comparison:

    • Quantitative assessment of signal transduction efficiency

    • Methodology: GTPγS binding assays with cognate G-proteins

    • Analysis: Determine activation rates and maximum activation levels

    • Key parameters: EC50 values, maximum activation levels, activation kinetics

  • Molecular Dynamics Simulations:

    • In silico comparison of structural dynamics

    • Methodology: Build homology models and run simulations under different conditions

    • Analysis: Compare flexibility of key regions, conformational changes upon activation

    • Validation: Correlate computational predictions with experimental measurements

  • Mutagenesis-Based Analysis:

    • Systematic exchange of key residues between L. kesslerii Rhodopsin and comparison pigments

    • Methodology: Site-directed mutagenesis followed by functional characterization

    • Analysis: Identify critical residues responsible for functional differences

    • Approach: Focus on residues in chromophore pocket and G-protein interaction sites

  • Thermal and Chemical Stability Comparison:

    • Assess resistance to denaturation under varying conditions

    • Methodology: Thermal denaturation curves, chemical denaturation with guanidinium chloride

    • Analysis: Compare melting temperatures (Tm) and denaturant concentration midpoints (Cm)

    • Relevance: Connects evolutionary adaptation to molecular stability properties

For valid comparisons, all visual pigments should be expressed, purified, and characterized under identical conditions using standardized protocols.

How might the structure-function relationships in L. kesslerii Rhodopsin inform the development of optogenetic tools?

The unique structure-function relationships in L. kesslerii Rhodopsin offer valuable insights for developing specialized optogenetic tools with distinct advantages:

  • Cold-Temperature Functionality:
    L. kesslerii Rhodopsin, adapted to function in the cold waters of Lake Baikal , likely contains structural features that maintain protein flexibility and proper folding at low temperatures. These features could be incorporated into optogenetic tools for:

    • Applications requiring function at reduced temperatures

    • Enhanced stability in neural implants with temperature fluctuations

    • Improved expression in systems where high temperature causes protein aggregation

  • Spectral Tuning Insights:
    The specific amino acid composition of L. kesslerii Rhodopsin's retinal binding pocket, adapted to freshwater depth conditions , provides:

    • Novel residue combinations for engineering spectral properties

    • Potential for developing optogenetic tools with unique activation wavelengths

    • Strategies for fine-tuning spectral sensitivity without compromising function

  • G-protein Coupling Characteristics:
    The cytoplasmic regions of L. kesslerii Rhodopsin may offer:

    • Alternative G-protein coupling interfaces for engineering signaling specificity

    • Potential for developing optogenetic tools with modified signaling kinetics

    • Templates for designing tools with reduced coupling to endogenous signaling pathways

  • Structural Stability Elements:
    The rhodopsin's adaptation to depths of up to 70 meters suggests enhanced structural stability that could be leveraged for:

    • Increasing the operational lifetime of optogenetic tools

    • Reducing aggregation propensity in high-expression systems

    • Engineering enhanced resistance to photobleaching

  • Crepuscular Adaptation Applications:
    L. kesslerii's crepuscular activity pattern suggests its rhodopsin has optimized:

    • Light sensitivity characteristics useful for low-light optogenetic applications

    • Potential for developing tools requiring minimal light intensity

    • Reduced phototoxicity potential for long-term in vivo applications

By systematically characterizing these structure-function relationships and comparing them with existing optogenetic tools, researchers can identify specific molecular features worth incorporating into next-generation optogenetic constructs with enhanced performance characteristics.

What are the most promising future research directions involving L. kesslerii Rhodopsin?

Based on current knowledge about L. kesslerii Rhodopsin and the unique ecological niche of Kessler's sculpin, several promising research directions emerge:

  • Comparative Visual Ecology:
    Investigating how the molecular properties of L. kesslerii Rhodopsin correlate with the visual ecology of Kessler's sculpin in Lake Baikal. This could include in-depth spectral sensitivity measurements correlated with the light environment at different depths (3-70m) where the fish resides .

  • Cold Adaptation Mechanisms:
    Exploring the specific molecular adaptations that allow L. kesslerii Rhodopsin to function effectively in the cold temperatures of Lake Baikal. This research could reveal generalizable principles of cold adaptation in membrane proteins with implications beyond vision research.

  • Evolutionary Genomics:
    Conducting comprehensive phylogenetic analyses comparing rhodopsin sequences across the diverse fish species of Lake Baikal to understand how this ancient lake has driven visual system evolution and specialization.

  • Structural Biology Approaches:
    Determining the high-resolution structure of L. kesslerii Rhodopsin using X-ray crystallography or cryo-electron microscopy would provide invaluable insights into its unique functional properties and evolutionary adaptations.

  • Optogenetic Applications:
    Developing novel optogenetic tools based on L. kesslerii Rhodopsin that leverage its unique properties for specific applications in neuroscience research, potentially offering advantages for certain experimental conditions.

  • Climate Change Impact Assessment:
    Investigating how increasing temperatures in Lake Baikal might affect the function of cold-adapted proteins like L. kesslerii Rhodopsin, with implications for understanding climate change impacts on specialized endemic species.

These research directions would not only advance our understanding of rhodopsin biology but also contribute to broader fields including evolutionary biology, structural biology, and conservation science.

What interdisciplinary approaches would be most valuable for advancing L. kesslerii Rhodopsin research?

Advancing L. kesslerii Rhodopsin research would benefit significantly from interdisciplinary approaches that integrate multiple scientific disciplines:

  • Integrating Ecological and Molecular Studies:
    Combining field studies of Kessler's sculpin in Lake Baikal with laboratory analysis of its rhodopsin would establish direct connections between environmental conditions, behavior, and molecular adaptations. This ecological context is crucial for understanding the selective pressures that shaped the rhodopsin's properties .

  • Computational Biology and Experimental Biophysics:
    Pairing molecular dynamics simulations with experimental biophysical measurements would provide complementary insights into how L. kesslerii Rhodopsin's structure relates to its function. This could reveal how specific amino acid substitutions contribute to cold adaptation or spectral tuning.

  • Evolutionary Biology and Structural Biology:
    Combining phylogenetic analysis of rhodopsin sequences from Lake Baikal fishes with structural studies would reveal how evolutionary processes have shaped protein structure and function in this unique ecosystem.

  • Neuroscience and Sensory Ecology:
    Integrating studies of L. kesslerii visual processing with rhodopsin biochemistry would connect molecular mechanisms to organismal function, providing insights into how visual system adaptations influence behavior and ecological interactions.

  • Biotechnology and Basic Science:
    Developing biotechnological applications of L. kesslerii Rhodopsin (such as optogenetic tools) in parallel with basic research would create a productive feedback loop, where applied research generates questions for basic science and vice versa.

  • Climate Science and Molecular Biology:
    Studying how changing environmental conditions affect L. kesslerii Rhodopsin function would connect climate science with molecular biology, providing a mechanistic understanding of how climate change might impact specialized species at the molecular level.

These interdisciplinary approaches would yield more comprehensive insights than any single discipline could provide independently, advancing our understanding of this unique visual pigment and its biological context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.