Recombinant Leontopithecus chrysomelas Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant MC1R from L. chrysomelas is a 310-amino-acid protein fused to an N-terminal polyhistidine (His) tag for purification and detection . Key specifications include:

ParameterDescription
Catalog No.RFL17645LF
SourceEscherichia coli (E. coli) expression system
SpeciesLeontopithecus chrysomelas (Golden-headed lion tamarin)
Protein LengthFull-length (1-310 amino acids)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for long-term storage

The amino acid sequence is:
MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENVLVVAAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLEAGVLATRASVVQQLHNTIDVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFITYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLAWACQHAQGIIRLHKRQPPAHKGFGLRGAATLTILLGIFFLCWGPFFLRLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAFRSQELRRTLKEVLGRGRW .

Ligand Binding and Signaling

  • Basal activity: Exhibits ligand-independent signaling, as demonstrated in murine and human homologs .

  • Agonist response: Binds α-melanocyte-stimulating hormone (α-MSH), activating adenylate cyclase to increase cAMP, which drives eumelanin synthesis .

Biological Pathways

MC1R is central to two key pathways:

PathwayRelated Proteins
MelanogenesisTYRP1B, EDNRBA, CALM2, PLCB1/2, WNT9A
Neuroactive ligand-receptor interactionADRB2A, GRIA2/3, CHRNA3, P2RY1

Mutations disrupting MC1R function correlate with pheomelanin overproduction, lighter pigmentation, and increased UV sensitivity .

Research Applications

  • Mechanistic studies: Investigating receptor dimerization, ligand binding kinetics, and intracellular trafficking .

  • Drug discovery: Screening for agonists/antagonists targeting hyperpigmentation disorders or melanoma .

  • Comparative biology: Analyzing evolutionary conservation of MC1R across primates .

Notes on Usage

  • Not for human use: Strictly intended for in vitro research .

  • Controls: Include wild-type and mutant MC1R variants to validate assay specificity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice packaging is required, please notify us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion during development.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Leontopithecus chrysomelas (Golden-headed lion tamarin)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLEAGVLATRASVVQQLHNTIDVLTCSSM LCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFITYYDHAAV LLCLVVFFLAMLVLMAVLYVHMLAWACQHAQGIIRLHKRQPPAHKGFGLRGAATLTILLG IFFLCWGPFFLRLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAFRSQELRRT LKEVLGRGRW
Uniprot No.

Target Background

Function
This receptor binds to MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the process of producing eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What methodologies are most effective for expressing recombinant L. chrysomelas MC1R?

Successful expression of functional recombinant L. chrysomelas MC1R requires careful consideration of expression systems and purification strategies. E. coli-based systems have been demonstrated to effectively produce the protein in sufficient quantities for research applications . The methodological approach includes:

  • Gene synthesis or cloning of the L. chrysomelas MC1R coding sequence into an appropriate expression vector

  • Transformation into competent E. coli cells optimized for membrane protein expression

  • Induction of protein expression under controlled temperature conditions (typically 18-25°C)

  • Cell lysis and membrane fraction isolation

  • Solubilization using mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol)

  • Purification via nickel affinity chromatography utilizing the His-tag

  • Size exclusion chromatography for final purification steps

For applications requiring higher eukaryotic post-translational modifications, insect cell or mammalian expression systems may be preferable, though with typically lower yield outcomes .

How does L. chrysomelas MC1R sequence conservation compare to human MC1R?

L. chrysomelas MC1R exhibits significant sequence homology with human MC1R, reflecting evolutionary conservation of this receptor across primate species. Sequence alignment studies reveal conservation particularly in:

  • Transmembrane domains critical for structural integrity

  • Ligand-binding regions that interact with α-MSH

  • Intracellular domains involved in G-protein coupling and signaling

The conservation patterns suggest functional significance, particularly in regions associated with DNA repair mechanisms and pigmentation control. Sequence divergence is more prominent in N-terminal and C-terminal regions, potentially reflecting species-specific adaptations to different environmental pressures .

Comparative studies indicate that MC1R is under strong functional constraint in African primate populations, where deviation from eumelanin production appears evolutionarily deleterious. In contrast, non-African populations show greater variability, suggesting relaxation of selective pressures .

What are the recommended methods for genotyping L. chrysomelas MC1R variants?

Genotyping L. chrysomelas MC1R variants requires precise methodologies to ensure accurate identification of genetic polymorphisms. Based on established protocols, researchers should consider:

  • Genomic DNA extraction from appropriate biological samples (blood, tissue, or non-invasive sources)

  • PCR amplification of the entire MC1R coding region (317 codons)

  • Automated sequencing using fluorescent dye-labeled primers

  • Confirmation of variants through repeat sequencing or RFLP analysis

  • Haplotype confirmation through cloning when necessary

For population studies, microsatellite amplification has proven effective using both species-specific primer pairs and heterologous primer pairs, as shown in the following table:

SpeciesLocusPrimers sequence (5'-3')RepeatFluorophoreT°C
L. chrysomelasLchu1F: GCTCAGGTGTTATTTATGTCCAAATetraPET58°C
R: GTTTCTTGCAACTATCTTGCATGTTCTGC
L. chrysomelasLchu3F: AAGGCATGATGTATCTTGTTCTCATetraFAM58°C
R: GTTTCTTATCTTTCTGTATGTGTCTCCCTGTCT
L. chrysomelasLchu4F: TGACCAAAGAAAATGCAAAATetraVIC55°C
R: GTTTCTTGCACAGGGTATTTAGCAGGA
L. chrysomelasLchu5F: TGATGCTAAAACAGAAGCATTTTetraNED55°C
R: GTTTCTTGTCCTGATGTTCACAAAACCT

These methods have been successfully employed to analyze genetic diversity in ex situ populations of the endangered L. chrysomelas .

How should researchers design functional assays to evaluate MC1R signaling activity in recombinant L. chrysomelas systems?

Designing robust functional assays for recombinant L. chrysomelas MC1R requires comprehensive strategies addressing multiple signaling pathways. A methodological framework should include:

  • cAMP Accumulation Assays:

    • Transfect cells (typically HEK293 or CHO) with recombinant L. chrysomelas MC1R expression constructs

    • Stimulate with α-MSH at concentration ranges of 10^-12 to 10^-6 M

    • Measure intracellular cAMP using competitive enzyme immunoassays or HTRF-based detection systems

    • Include positive controls (wild-type human MC1R) and negative controls (empty vector)

  • ERK/MAPK Phosphorylation Analysis:

    • Western blot analysis of phospho-ERK levels following α-MSH stimulation

    • Time-course experiments (0-60 minutes) to capture signaling dynamics

    • Quantification via densitometry with normalization to total ERK levels

  • Calcium Mobilization Assays:

    • Load transfected cells with calcium-sensitive fluorophores (Fura-2/AM)

    • Monitor real-time calcium flux following ligand administration

    • Calculate EC50 values for quantitative comparisons between variants

  • Receptor Trafficking Studies:

    • Generate fluorescently tagged MC1R constructs

    • Perform live-cell imaging to monitor internalization kinetics

    • Quantify surface expression using cell-impermeable biotinylation assays

Validation should include testing for species-specific responses to ligands, as evolutionary divergence may affect signaling parameters compared to human MC1R systems .

What are the critical considerations when analyzing MC1R expression patterns in melanoma progression models using L. chrysomelas MC1R antibodies?

Analysis of MC1R expression in melanoma progression models using L. chrysomelas MC1R antibodies requires meticulous attention to methodological details:

  • Antibody Validation Requirements:

    • Cross-reactivity profiling against human and other primate MC1R variants

    • Specificity verification using MC1R knockout controls or peptide competition assays

    • Titration experiments to determine optimal concentrations for different applications

  • Quantitative Immunofluorescence Protocol:

    • Sample preparation standardization (fixation parameters, antigen retrieval methods)

    • Multiple independent antibody incubations with consistent time/temperature conditions

    • Automated image acquisition with fixed exposure parameters

    • Quantitative analysis using validated image processing algorithms

  • Expression Pattern Analysis Framework:

    • Stratification of samples by melanoma progression stage (benign nevi, primary, metastasis)

    • Correlation with histopathological parameters (depth, ulceration status)

    • Comparison of expression between different melanoma subtypes (cutaneous vs. mucosal)

  • Statistical Approaches:

    • Normalization to control proteins and reference standards

    • Use of multiple statistical tests (t-tests, ANOVA) after confirming data normality

    • Implementation of appropriate multiple testing corrections

Recent studies have demonstrated a stepwise elevation of MC1R expression during melanoma progression, with higher expression observed in deeper primary lesions, ulcerated lesions, and mucosal melanomas compared to cutaneous melanomas . This pattern indicates potential value of MC1R as a biomarker for disease progression and therapeutic targeting.

How can researchers address MC1R variant functionality differences between human and L. chrysomelas systems in translational research?

Addressing functional differences between human and L. chrysomelas MC1R variants requires systematic comparative approaches:

  • Parallel Mutagenesis Strategy:

    • Generate equivalent mutations in both human and L. chrysomelas MC1R constructs

    • Create chimeric receptors with domain swapping to identify species-specific functional regions

    • Implement site-directed mutagenesis to evaluate the impact of species-divergent residues

  • Comparative Pharmacological Profiling:

    • Determine dose-response relationships for natural and synthetic ligands

    • Calculate binding affinity constants using radioligand binding assays

    • Assess biased signaling through multiple pathway readouts (G-protein vs. β-arrestin)

  • Species-Specific Signaling Context Analysis:

    • Co-express with species-matched downstream effectors

    • Evaluate receptor palmitoylation patterns, which are critical for MC1R function

    • Analyze UV response pathways in matched cellular backgrounds

  • Translational Relevance Assessment:

    • Correlate variant effects with phenotypic outcomes in human and L. chrysomelas populations

    • Develop predictive models for cross-species functionality translation

    • Implement molecular dynamics simulations to understand structural implications of variants

Research has shown that some human MC1R variants, particularly the RHC-variants (V60L, I40T, R142H, R151C, R162P, R160W, and D294H), demonstrate reduced capacity to stimulate cAMP production in response to α-MSH compared to wild-type receptors . Comparative analysis with L. chrysomelas variants can provide evolutionary insights into receptor function optimization.

What methodological approaches should be employed to investigate MC1R's role in DNA repair mechanisms using recombinant L. chrysomelas MC1R?

Investigating MC1R's role in DNA repair requires sophisticated methodological approaches:

  • UV-Induced DNA Damage Assessment:

    • Expose cells expressing recombinant L. chrysomelas MC1R to controlled UV radiation doses

    • Quantify cyclobutane pyrimidine dimers (CPDs) and 6-4 photoproducts using specific antibodies

    • Track damage repair kinetics over time (0-48 hours post-irradiation)

    • Compare repair efficiency between wild-type and variant MC1R expressions

  • Chromosomal Stability Analysis:

    • Metaphase spread preparation from MC1R-expressing cells after UV exposure

    • Assessment of chromosomal aberrations, particularly centromeric fragmentations

    • Quantification of micronuclei formation as indicators of genome instability

    • Correlation of aberration frequency with MC1R functional status

  • DNA Repair Pathway Interaction Studies:

    • Co-immunoprecipitation experiments to identify DNA repair proteins that interact with MC1R

    • Proximity ligation assays to confirm protein-protein interactions in situ

    • siRNA knockdown of specific repair pathway components to establish dependency relationships

    • Chromatin immunoprecipitation to assess recruitment of repair factors to damage sites

  • Functional Rescue Experiments:

    • Complementation studies in MC1R-deficient backgrounds

    • Palmitoylation activation assays to rescue loss-of-function variants

    • Treatment with DNA repair modulators to establish pathway specificity

Research has demonstrated that α-MSH/MC1R signaling protects melanocytes from accumulating UV-induced chromosome aberrations, with particularly high protection against centromeric fragmentations . This protection appears to be palmitoylation-dependent, suggesting potential therapeutic strategies for individuals with MC1R variants.

How can researchers effectively design radiopharmaceutical targeting studies using recombinant L. chrysomelas MC1R as a model system?

Designing radiopharmaceutical targeting studies with recombinant L. chrysomelas MC1R requires rigorous multidisciplinary approaches:

  • Receptor-Ligand Binding Optimization:

    • Develop peptide mimetics derived from α-MSH with enhanced receptor selectivity

    • Perform structure-activity relationship studies to identify optimal binding motifs

    • Incorporate chelating groups at positions that maintain receptor binding affinities

    • Validate binding kinetics using surface plasmon resonance or radioligand competition assays

  • Radiochemistry Considerations:

    • Optimize radiolabeling conditions for various isotopes (212Pb, 225Ac, 203Pb)

    • Develop quality control procedures to ensure radiochemical purity

    • Establish stability assessments in physiologically relevant conditions

    • Implement microfluidic approaches for rapid screening of radiolabeled candidates

  • Biodistribution and Pharmacokinetic Analysis:

    • Utilize SPECT imaging with surrogate radionuclides (e.g., 203Pb) to predict therapeutic distribution

    • Calculate dosimetry estimates for therapeutic isotopes based on imaging results

    • Determine optimal dose and administration schedules through iterative testing

    • Implement compartmental modeling to predict tissue exposure levels

  • Translational Efficacy Evaluation Framework:

    • Establish xenograft models expressing varying levels of target receptor

    • Correlate receptor expression with therapeutic response

    • Monitor immune system remodeling following alpha-particle therapy

    • Develop combination strategies with immune checkpoint inhibitors

Current clinical trials are investigating MC1R-targeting radiopharmaceuticals, such as [212Pb]VMT01, for treating unresectable or metastatic melanoma. A phase I dose-escalation and expansion trial involving up to 52 patients is currently underway to determine the maximum tolerated dose . This approach leverages the increased expression of MC1R observed in progressive stages of melanoma.

What analytical strategies should researchers employ when investigating genetic diversity in MC1R across L. chrysomelas populations?

Analyzing genetic diversity in MC1R across L. chrysomelas populations requires comprehensive analytical strategies:

  • Sampling Design Considerations:

    • Geographic stratification to capture potential adaptation to local environments

    • Inclusion of both captive and wild populations to assess conservation implications

    • Sampling across age groups to detect potential temporal shifts in allele frequencies

    • Inclusion of related species for comparative evolutionary analyses

  • Advanced Genotyping Approaches:

    • Full-sequence characterization of the MC1R coding region and regulatory elements

    • Next-generation sequencing to detect low-frequency variants

    • Linkage disequilibrium analysis with neighboring genomic regions

    • Identification of copy number variations that may affect gene dosage

  • Population Genetic Analysis Framework:

    • Calculation of genetic diversity parameters (H₀, Hₑ, Aₙ)

    • Implementation of principal coordinate analysis (PCoA) for population differentiation

    • Bayesian clustering to determine genetic group structures

    • Fixation index (FST) calculation between populations

  • Evolutionary Timeline Reconstruction:

    • Application of coalescence models to estimate the time scale of polymorphic variation

    • Conditional estimation based on maximum-likelihood for population mutation rate parameters

    • Gene tree construction representing complete sequence information

    • Assessment of selective pressures across different geographic regions

Studies have shown that MC1R is under strong functional constraint in African populations, where deviation from eumelanin production appears evolutionarily deleterious. In contrast, non-African populations exhibit greater MC1R diversity, reflecting neutral expectations under relaxation of strong functional constraint .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.