Recombinant MC1R from L. chrysomelas is a 310-amino-acid protein fused to an N-terminal polyhistidine (His) tag for purification and detection . Key specifications include:
| Parameter | Description |
|---|---|
| Catalog No. | RFL17645LF |
| Source | Escherichia coli (E. coli) expression system |
| Species | Leontopithecus chrysomelas (Golden-headed lion tamarin) |
| Protein Length | Full-length (1-310 amino acids) |
| Purity | >90% (SDS-PAGE verified) |
| Form | Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) |
| Reconstitution | 0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for long-term storage |
The amino acid sequence is:
MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENVLVVAAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLEAGVLATRASVVQQLHNTIDVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFITYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLAWACQHAQGIIRLHKRQPPAHKGFGLRGAATLTILLGIFFLCWGPFFLRLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAFRSQELRRTLKEVLGRGRW .
Basal activity: Exhibits ligand-independent signaling, as demonstrated in murine and human homologs .
Agonist response: Binds α-melanocyte-stimulating hormone (α-MSH), activating adenylate cyclase to increase cAMP, which drives eumelanin synthesis .
MC1R is central to two key pathways:
| Pathway | Related Proteins |
|---|---|
| Melanogenesis | TYRP1B, EDNRBA, CALM2, PLCB1/2, WNT9A |
| Neuroactive ligand-receptor interaction | ADRB2A, GRIA2/3, CHRNA3, P2RY1 |
Mutations disrupting MC1R function correlate with pheomelanin overproduction, lighter pigmentation, and increased UV sensitivity .
Mechanistic studies: Investigating receptor dimerization, ligand binding kinetics, and intracellular trafficking .
Drug discovery: Screening for agonists/antagonists targeting hyperpigmentation disorders or melanoma .
Comparative biology: Analyzing evolutionary conservation of MC1R across primates .
Successful expression of functional recombinant L. chrysomelas MC1R requires careful consideration of expression systems and purification strategies. E. coli-based systems have been demonstrated to effectively produce the protein in sufficient quantities for research applications . The methodological approach includes:
Gene synthesis or cloning of the L. chrysomelas MC1R coding sequence into an appropriate expression vector
Transformation into competent E. coli cells optimized for membrane protein expression
Induction of protein expression under controlled temperature conditions (typically 18-25°C)
Cell lysis and membrane fraction isolation
Solubilization using mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol)
Purification via nickel affinity chromatography utilizing the His-tag
Size exclusion chromatography for final purification steps
For applications requiring higher eukaryotic post-translational modifications, insect cell or mammalian expression systems may be preferable, though with typically lower yield outcomes .
L. chrysomelas MC1R exhibits significant sequence homology with human MC1R, reflecting evolutionary conservation of this receptor across primate species. Sequence alignment studies reveal conservation particularly in:
Transmembrane domains critical for structural integrity
Ligand-binding regions that interact with α-MSH
Intracellular domains involved in G-protein coupling and signaling
The conservation patterns suggest functional significance, particularly in regions associated with DNA repair mechanisms and pigmentation control. Sequence divergence is more prominent in N-terminal and C-terminal regions, potentially reflecting species-specific adaptations to different environmental pressures .
Comparative studies indicate that MC1R is under strong functional constraint in African primate populations, where deviation from eumelanin production appears evolutionarily deleterious. In contrast, non-African populations show greater variability, suggesting relaxation of selective pressures .
Genotyping L. chrysomelas MC1R variants requires precise methodologies to ensure accurate identification of genetic polymorphisms. Based on established protocols, researchers should consider:
Genomic DNA extraction from appropriate biological samples (blood, tissue, or non-invasive sources)
PCR amplification of the entire MC1R coding region (317 codons)
Automated sequencing using fluorescent dye-labeled primers
Confirmation of variants through repeat sequencing or RFLP analysis
Haplotype confirmation through cloning when necessary
For population studies, microsatellite amplification has proven effective using both species-specific primer pairs and heterologous primer pairs, as shown in the following table:
| Species | Locus | Primers sequence (5'-3') | Repeat | Fluorophore | T°C |
|---|---|---|---|---|---|
| L. chrysomelas | Lchu1 | F: GCTCAGGTGTTATTTATGTCCAAA | Tetra | PET | 58°C |
| R: GTTTCTTGCAACTATCTTGCATGTTCTGC | |||||
| L. chrysomelas | Lchu3 | F: AAGGCATGATGTATCTTGTTCTCA | Tetra | FAM | 58°C |
| R: GTTTCTTATCTTTCTGTATGTGTCTCCCTGTCT | |||||
| L. chrysomelas | Lchu4 | F: TGACCAAAGAAAATGCAAAA | Tetra | VIC | 55°C |
| R: GTTTCTTGCACAGGGTATTTAGCAGGA | |||||
| L. chrysomelas | Lchu5 | F: TGATGCTAAAACAGAAGCATTT | Tetra | NED | 55°C |
| R: GTTTCTTGTCCTGATGTTCACAAAACCT |
These methods have been successfully employed to analyze genetic diversity in ex situ populations of the endangered L. chrysomelas .
Designing robust functional assays for recombinant L. chrysomelas MC1R requires comprehensive strategies addressing multiple signaling pathways. A methodological framework should include:
cAMP Accumulation Assays:
Transfect cells (typically HEK293 or CHO) with recombinant L. chrysomelas MC1R expression constructs
Stimulate with α-MSH at concentration ranges of 10^-12 to 10^-6 M
Measure intracellular cAMP using competitive enzyme immunoassays or HTRF-based detection systems
Include positive controls (wild-type human MC1R) and negative controls (empty vector)
ERK/MAPK Phosphorylation Analysis:
Western blot analysis of phospho-ERK levels following α-MSH stimulation
Time-course experiments (0-60 minutes) to capture signaling dynamics
Quantification via densitometry with normalization to total ERK levels
Calcium Mobilization Assays:
Load transfected cells with calcium-sensitive fluorophores (Fura-2/AM)
Monitor real-time calcium flux following ligand administration
Calculate EC50 values for quantitative comparisons between variants
Receptor Trafficking Studies:
Generate fluorescently tagged MC1R constructs
Perform live-cell imaging to monitor internalization kinetics
Quantify surface expression using cell-impermeable biotinylation assays
Validation should include testing for species-specific responses to ligands, as evolutionary divergence may affect signaling parameters compared to human MC1R systems .
Analysis of MC1R expression in melanoma progression models using L. chrysomelas MC1R antibodies requires meticulous attention to methodological details:
Antibody Validation Requirements:
Cross-reactivity profiling against human and other primate MC1R variants
Specificity verification using MC1R knockout controls or peptide competition assays
Titration experiments to determine optimal concentrations for different applications
Quantitative Immunofluorescence Protocol:
Sample preparation standardization (fixation parameters, antigen retrieval methods)
Multiple independent antibody incubations with consistent time/temperature conditions
Automated image acquisition with fixed exposure parameters
Quantitative analysis using validated image processing algorithms
Expression Pattern Analysis Framework:
Stratification of samples by melanoma progression stage (benign nevi, primary, metastasis)
Correlation with histopathological parameters (depth, ulceration status)
Comparison of expression between different melanoma subtypes (cutaneous vs. mucosal)
Statistical Approaches:
Normalization to control proteins and reference standards
Use of multiple statistical tests (t-tests, ANOVA) after confirming data normality
Implementation of appropriate multiple testing corrections
Recent studies have demonstrated a stepwise elevation of MC1R expression during melanoma progression, with higher expression observed in deeper primary lesions, ulcerated lesions, and mucosal melanomas compared to cutaneous melanomas . This pattern indicates potential value of MC1R as a biomarker for disease progression and therapeutic targeting.
Addressing functional differences between human and L. chrysomelas MC1R variants requires systematic comparative approaches:
Parallel Mutagenesis Strategy:
Generate equivalent mutations in both human and L. chrysomelas MC1R constructs
Create chimeric receptors with domain swapping to identify species-specific functional regions
Implement site-directed mutagenesis to evaluate the impact of species-divergent residues
Comparative Pharmacological Profiling:
Determine dose-response relationships for natural and synthetic ligands
Calculate binding affinity constants using radioligand binding assays
Assess biased signaling through multiple pathway readouts (G-protein vs. β-arrestin)
Species-Specific Signaling Context Analysis:
Co-express with species-matched downstream effectors
Evaluate receptor palmitoylation patterns, which are critical for MC1R function
Analyze UV response pathways in matched cellular backgrounds
Translational Relevance Assessment:
Correlate variant effects with phenotypic outcomes in human and L. chrysomelas populations
Develop predictive models for cross-species functionality translation
Implement molecular dynamics simulations to understand structural implications of variants
Research has shown that some human MC1R variants, particularly the RHC-variants (V60L, I40T, R142H, R151C, R162P, R160W, and D294H), demonstrate reduced capacity to stimulate cAMP production in response to α-MSH compared to wild-type receptors . Comparative analysis with L. chrysomelas variants can provide evolutionary insights into receptor function optimization.
Investigating MC1R's role in DNA repair requires sophisticated methodological approaches:
UV-Induced DNA Damage Assessment:
Expose cells expressing recombinant L. chrysomelas MC1R to controlled UV radiation doses
Quantify cyclobutane pyrimidine dimers (CPDs) and 6-4 photoproducts using specific antibodies
Track damage repair kinetics over time (0-48 hours post-irradiation)
Compare repair efficiency between wild-type and variant MC1R expressions
Chromosomal Stability Analysis:
Metaphase spread preparation from MC1R-expressing cells after UV exposure
Assessment of chromosomal aberrations, particularly centromeric fragmentations
Quantification of micronuclei formation as indicators of genome instability
Correlation of aberration frequency with MC1R functional status
DNA Repair Pathway Interaction Studies:
Co-immunoprecipitation experiments to identify DNA repair proteins that interact with MC1R
Proximity ligation assays to confirm protein-protein interactions in situ
siRNA knockdown of specific repair pathway components to establish dependency relationships
Chromatin immunoprecipitation to assess recruitment of repair factors to damage sites
Functional Rescue Experiments:
Complementation studies in MC1R-deficient backgrounds
Palmitoylation activation assays to rescue loss-of-function variants
Treatment with DNA repair modulators to establish pathway specificity
Research has demonstrated that α-MSH/MC1R signaling protects melanocytes from accumulating UV-induced chromosome aberrations, with particularly high protection against centromeric fragmentations . This protection appears to be palmitoylation-dependent, suggesting potential therapeutic strategies for individuals with MC1R variants.
Designing radiopharmaceutical targeting studies with recombinant L. chrysomelas MC1R requires rigorous multidisciplinary approaches:
Receptor-Ligand Binding Optimization:
Develop peptide mimetics derived from α-MSH with enhanced receptor selectivity
Perform structure-activity relationship studies to identify optimal binding motifs
Incorporate chelating groups at positions that maintain receptor binding affinities
Validate binding kinetics using surface plasmon resonance or radioligand competition assays
Radiochemistry Considerations:
Optimize radiolabeling conditions for various isotopes (212Pb, 225Ac, 203Pb)
Develop quality control procedures to ensure radiochemical purity
Establish stability assessments in physiologically relevant conditions
Implement microfluidic approaches for rapid screening of radiolabeled candidates
Biodistribution and Pharmacokinetic Analysis:
Utilize SPECT imaging with surrogate radionuclides (e.g., 203Pb) to predict therapeutic distribution
Calculate dosimetry estimates for therapeutic isotopes based on imaging results
Determine optimal dose and administration schedules through iterative testing
Implement compartmental modeling to predict tissue exposure levels
Translational Efficacy Evaluation Framework:
Establish xenograft models expressing varying levels of target receptor
Correlate receptor expression with therapeutic response
Monitor immune system remodeling following alpha-particle therapy
Develop combination strategies with immune checkpoint inhibitors
Current clinical trials are investigating MC1R-targeting radiopharmaceuticals, such as [212Pb]VMT01, for treating unresectable or metastatic melanoma. A phase I dose-escalation and expansion trial involving up to 52 patients is currently underway to determine the maximum tolerated dose . This approach leverages the increased expression of MC1R observed in progressive stages of melanoma.
Analyzing genetic diversity in MC1R across L. chrysomelas populations requires comprehensive analytical strategies:
Sampling Design Considerations:
Geographic stratification to capture potential adaptation to local environments
Inclusion of both captive and wild populations to assess conservation implications
Sampling across age groups to detect potential temporal shifts in allele frequencies
Inclusion of related species for comparative evolutionary analyses
Advanced Genotyping Approaches:
Full-sequence characterization of the MC1R coding region and regulatory elements
Next-generation sequencing to detect low-frequency variants
Linkage disequilibrium analysis with neighboring genomic regions
Identification of copy number variations that may affect gene dosage
Population Genetic Analysis Framework:
Calculation of genetic diversity parameters (H₀, Hₑ, Aₙ)
Implementation of principal coordinate analysis (PCoA) for population differentiation
Bayesian clustering to determine genetic group structures
Fixation index (FST) calculation between populations
Evolutionary Timeline Reconstruction:
Application of coalescence models to estimate the time scale of polymorphic variation
Conditional estimation based on maximum-likelihood for population mutation rate parameters
Gene tree construction representing complete sequence information
Assessment of selective pressures across different geographic regions
Studies have shown that MC1R is under strong functional constraint in African populations, where deviation from eumelanin production appears evolutionarily deleterious. In contrast, non-African populations exhibit greater MC1R diversity, reflecting neutral expectations under relaxation of strong functional constraint .