Recombinant Leontopithecus chrysopygus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Expression Systems

  • Host: Primarily expressed in Escherichia coli for cost-effective production .

  • Tagging: N-terminal His-tag facilitates affinity chromatography purification .

Key Applications

  1. Ligand Binding Studies: Used to characterize α-MSH binding kinetics and receptor activation mechanisms .

  2. DNA Repair Assays: Evaluates MC1R's role in UV-induced photolesion repair via ATR/XPA recruitment .

  3. Melanoma Research: Assesses MC1R loss-of-function mutations (e.g., RHC variants) linked to impaired PTEN regulation and PI3K/Akt pathway activation .

  4. Comparative Evolutionary Studies: Analyzes MC1R polymorphisms in primates to understand coat-color evolution .

Experimental Findings

  • Constitutive Activity: MC1R exhibits ligand-independent basal cAMP signaling, critical for melanocyte survival .

  • Dimerization: Covalent/non-covalent interactions stabilize homodimers, essential for ER-to-plasma membrane trafficking .

  • Therapeutic Potential: Forskolin (adenylyl cyclase activator) restores DNA repair capacity in MC1R-deficient melanocytes .

Challenges and Future Directions

  • Stability Issues: MC1R’s hydrophobic transmembrane domains complicate solubilization and crystallization .

  • Species-Specificity: Functional differences between primate MC1R orthologs necessitate cautious extrapolation to human studies .

  • Therapeutic Targeting: Small-molecule agonists (e.g., α-MSH analogs) and palmitoylation enhancers are under investigation to rescue MC1R loss-of-function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Leontopithecus chrysopygus (Golden-rumped lion tamarin) (Leontopithecus rosalia chrysopygus)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGVLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFI TYYDHAAVLLCLMVFFLAMLVLMAVLYVHMLARARQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRMLKEVLGRGRW
Uniprot No.

Target Background

Function
This receptor acts as a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins that activate adenylate cyclase. It regulates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), through cAMP signaling regulation in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the MC1R protein and what is its significance in Leontopithecus species?

The Melanocyte-stimulating hormone receptor (MC1R) is a G-protein coupled receptor that plays a critical role in regulating pigmentation in mammals. In primates, including the Leontopithecus genus (lion tamarins), MC1R is involved in determining coat color patterns through the regulation of eumelanin (brown/black pigments) and pheomelanin (yellow/red pigments) production. Studies in related species such as Leontopithecus rosalia have revealed that MC1R exhibits a higher-than-expected dN/dS ratio (0.91), with several substitutions and deletions at functionally important sites, suggesting the red hair phenotype observed in L. rosalia may result from loss of function in MC1R . Comparative analyses within primate families have demonstrated that MC1R evolution is primarily driven by purifying selection, with specific lineages showing distinctive nonsynonymous mutations correlated with coat color phenotypes .

How is recombinant MC1R protein typically expressed and purified for research applications?

Recombinant MC1R protein is commonly expressed using prokaryotic expression systems such as E. coli, as seen with related Leontopithecus chrysomelas MC1R protein . The standard approach involves:

  • Cloning the full-length coding sequence (typically 1-310 amino acids for primate MC1R) into an expression vector

  • Adding an affinity tag (commonly His-tag at the N-terminus) to facilitate purification

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the recombinant protein using affinity chromatography

  • Confirming purity via SDS-PAGE (typically >90% purity is achievable)

  • Lyophilizing the purified protein for long-term storage

For L. chrysopygus MC1R specifically, expression conditions would need to be optimized based on the protein's amino acid sequence and physiochemical properties, potentially drawing from established protocols for other primate MC1R proteins.

What are the optimal storage conditions for maintaining MC1R protein stability?

Based on established protocols for similar recombinant proteins, the following storage conditions are recommended for maintaining MC1R protein stability:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (with 50% being optimal) as a cryoprotectant for reconstituted protein

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • For short-term use, working aliquots can be maintained at 4°C for up to one week

  • For buffer conditions, Tris/PBS-based buffers at pH 8.0 containing 6% Trehalose provide optimal stability

Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity and functional activity.

How can researchers design binding assays to characterize the interaction between recombinant L. chrysopygus MC1R and melanocortin peptides?

Researchers can implement several methodological approaches to characterize MC1R-ligand interactions:

Radioligand Binding Assays:

  • Prepare membrane fractions containing recombinant L. chrysopygus MC1R

  • Use radiolabeled melanocortin peptides (typically 125I-labeled α-MSH)

  • Perform saturation binding experiments with increasing concentrations of labeled ligand

  • For competition binding, use fixed concentration of labeled ligand with increasing concentrations of unlabeled ligands

  • Calculate binding parameters (Kd, Bmax, Ki) using nonlinear regression analysis

Functional Assays:

  • Use cell-based systems expressing recombinant L. chrysopygus MC1R

  • Measure cAMP accumulation using ELISA or reporter gene assays

  • Analyze dose-response relationships to determine EC50 values

Surface Plasmon Resonance (SPR):

  • Immobilize purified recombinant MC1R on sensor chips

  • Flow melanocortin peptides at various concentrations over the sensor surface

  • Determine association and dissociation rate constants

  • Calculate binding affinities from kinetic parameters

When conducting these assays, it's important to include both positive controls (such as human or other well-characterized primate MC1R) and negative controls to validate assay performance and specificity.

What comparative approaches can be used to study evolutionary conservation of MC1R across Leontopithecus species?

To investigate the evolutionary conservation of MC1R across Leontopithecus species, researchers should implement a multi-faceted approach:

Sequence Analysis:

  • Amplify and sequence MC1R genes from multiple Leontopithecus species (L. chrysopygus, L. rosalia, L. chrysomelas)

  • Align sequences and identify conserved and variable regions

  • Calculate evolutionary parameters (dN/dS ratios) to detect signatures of selection

  • Map nonsynonymous substitutions to functional domains of the receptor

Structural Comparison:

  • Generate 3D homology models of MC1R from different species

  • Compare the spatial arrangement of substitutions

  • Assess potential impacts on ligand binding and G-protein coupling

Functional Characterization:

  • Express recombinant MC1R from multiple species

  • Compare their pharmacological properties (binding affinity, signaling efficacy)

  • Correlate functional differences with sequence variations

Previous studies indicate that Leontopithecus rosalia shows an elevated dN/dS ratio (0.91) that was not significantly different from 1, with several substitutions at functionally important sites . This suggests potential species-specific adaptations in MC1R function that may correlate with the distinctive coat coloration patterns observed across the genus.

How can researchers investigate the signaling pathways activated by L. chrysopygus MC1R compared to other primate MC1Rs?

To investigate signaling pathways activated by L. chrysopygus MC1R compared to other primate MC1Rs, researchers can implement the following comprehensive approach:

Expression System Preparation:

  • Generate stable cell lines expressing recombinant L. chrysopygus MC1R

  • In parallel, prepare cells expressing MC1R from other primates (human, other tamarins, or related species)

  • Confirm receptor expression levels using Western blotting and flow cytometry

Signaling Pathway Analysis:

  • Measure cAMP production using ELISA or FRET-based sensors following stimulation with various concentrations of α-MSH and other melanocortins

  • Assess ERK1/2 phosphorylation using phospho-specific antibodies

  • Investigate calcium mobilization using fluorescent calcium indicators

  • Examine β-arrestin recruitment using bioluminescence resonance energy transfer (BRET)

Downstream Effects:

  • Measure eumelanin/pheomelanin production in melanocytes expressing the different MC1Rs

  • Analyze gene expression changes using RNA-seq following receptor activation

  • Investigate receptor internalization and trafficking using confocal microscopy

Data Analysis:

  • Compare EC50 values across different pathways and different species' receptors

  • Analyze signaling bias by calculating transduction coefficients

  • Correlate signaling properties with sequence differences among receptors

This comparative approach will help identify species-specific adaptations in MC1R signaling that may underlie the distinctive coat coloration patterns observed in L. chrysopygus and other Leontopithecus species.

What are the key functional domains of L. chrysopygus MC1R and how do they compare to other primates?

The MC1R protein in primates, including L. chrysopygus, is a seven-transmembrane G-protein coupled receptor with several conserved functional domains. Based on comparative analysis with related species:

Key Functional Domains:

DomainAmino Acid PositionFunctionConservation in Primates
N-terminal extracellular domain1-27Ligand recognitionModerate variability
Transmembrane domain 128-53Membrane anchoringHighly conserved
Intracellular loop 154-60G-protein couplingHighly conserved
Transmembrane domain 261-81Structural integrityHighly conserved
Extracellular loop 182-93Ligand bindingModerate variability
Transmembrane domain 394-117Ligand binding pocketHighly conserved
Intracellular loop 2118-138G-protein activationHighly conserved
Transmembrane domains 4-7139-290Receptor conformationHighly conserved
C-terminal tail291-310Receptor traffickingVariable

Studies in related Leontopithecus species have identified several nonsynonymous substitutions that may affect receptor function. For example, in L. rosalia, substitutions at functionally important sites have been linked to its distinctive golden coat coloration . Comparative sequence analysis of L. chrysopygus MC1R would likely reveal similar species-specific adaptations that correlate with its unique black coat coloration.

What methodologies are most effective for studying the pharmacological properties of recombinant L. chrysopygus MC1R?

To comprehensively characterize the pharmacological properties of recombinant L. chrysopygus MC1R, researchers should employ multiple complementary methodologies:

Ligand Binding Characterization:

  • Saturation binding assays with radiolabeled melanocortin peptides

  • Competition binding assays with various melanocortin receptor agonists and antagonists

  • Kinetic binding studies to determine association and dissociation rates

Functional Response Assays:

  • cAMP accumulation assays using ELISA or FRET-based sensors

  • Intracellular calcium mobilization measurements

  • ERK1/2 phosphorylation detection via Western blotting or ELISA

  • Gene reporter assays (e.g., CRE-luciferase)

Receptor Trafficking Studies:

  • Fluorescently tagged receptor imaging using confocal microscopy

  • Receptor internalization assays following agonist exposure

  • Recycling and degradation pathway analysis

Biophysical Characterization:

  • Circular dichroism spectroscopy to assess secondary structure

  • Thermostability assays to evaluate conformational stability

  • Surface plasmon resonance to determine binding kinetics

These methodologies should be systematically applied comparing wild-type and mutant versions of the receptor, as well as in comparison with MC1R from other primate species, to develop a comprehensive pharmacological profile.

How do mutations in the MC1R gene correlate with coat color phenotypes in Leontopithecus species?

The relationship between MC1R mutations and coat color phenotypes in Leontopithecus species represents a fascinating case study in evolutionary adaptation. Based on available research:

MC1R Variants and Phenotypic Correlations:

Leontopithecus SpeciesCoat Color PhenotypeMC1R Sequence FeaturesFunctional Impact
L. rosaliaGolden/orange pelageHigher dN/dS ratio (0.91); several substitutions and deletions at functionally important sitesPotential loss of function leading to increased pheomelanin (yellow/red pigment) production
L. chrysomelasBlack head with golden bodyIntermediate sequence variationsPartial modification of signaling favoring region-specific melanin distribution
L. chrysopygusPredominantly black pelageLimited data available; likely exhibits functional MC1RFully functional receptor promoting eumelanin (black/brown pigment) production

Research in other mammalian species has established that loss-of-function mutations in MC1R typically result in yellow/red phenotypes due to default pheomelanin production, while functional MC1R promotes eumelanin production resulting in brown/black phenotypes. The molecular basis of the distinctive coat patterns in Leontopithecus species likely involves complex interactions between MC1R variants and other genes in the melanogenesis pathway.

Further studies specifically targeting the L. chrysopygus MC1R would be valuable to identify the molecular mechanisms underlying its predominantly black coat color compared to the more golden/orange phenotypes of other lion tamarins.

What are the critical factors to consider when designing experiments with recombinant L. chrysopygus MC1R?

When designing experiments with recombinant L. chrysopygus MC1R, researchers should carefully consider several critical factors:

Expression System Selection:

  • Prokaryotic systems (E. coli) are suitable for basic binding studies but lack post-translational modifications

  • Mammalian expression systems (HEK293, CHO cells) provide more physiologically relevant receptor processing

  • Insect cell systems offer intermediate complexity with efficient expression

Protein Modification and Tagging:

  • N-terminal vs. C-terminal tags can differentially affect receptor function

  • His-tags facilitate purification but may influence ligand binding

  • Fluorescent protein fusions enable trafficking studies but can alter receptor dynamics

Experimental Controls:

  • Include well-characterized MC1R variants (e.g., human MC1R) as positive controls

  • Include inactive receptor mutants as negative controls

  • Validate antibody specificity with knockout/knockdown controls

Assay Validation:

  • Confirm receptor expression levels before functional studies

  • Establish dose-response relationships for standard agonists

  • Verify signal specificity using selective antagonists

  • Use multiple complementary assays to confirm findings

Physiological Relevance:

  • Consider temperature sensitivity of receptor-ligand interactions

  • Account for species-specific differences in signaling machinery

  • Relate in vitro findings to in vivo coat color phenotypes

By systematically addressing these factors, researchers can design robust experiments that yield reliable and physiologically relevant insights into L. chrysopygus MC1R function.

What are common challenges in recombinant MC1R protein production and how can they be addressed?

Producing high-quality recombinant MC1R protein presents several technical challenges that researchers should anticipate and address:

Challenge: Poor Expression Levels

  • Solution: Optimize codon usage for the expression system

  • Solution: Test multiple expression vectors with different promoters

  • Solution: Evaluate different E. coli strains (BL21, Rosetta, Origami)

  • Solution: Adjust induction conditions (temperature, IPTG concentration, duration)

Challenge: Protein Insolubility/Inclusion Bodies

  • Solution: Express as fusion protein with solubility enhancers (MBP, SUMO, Thioredoxin)

  • Solution: Lower induction temperature (16-20°C)

  • Solution: Add solubilizing agents during lysis (mild detergents)

  • Solution: Develop refolding protocols if extraction from inclusion bodies is necessary

Challenge: Protein Instability

  • Solution: Include protease inhibitors throughout purification

  • Solution: Add stabilizing agents (glycerol, trehalose) to storage buffer

  • Solution: Aliquot and flash-freeze samples to avoid freeze-thaw cycles

  • Solution: Store at optimal pH (typically pH 7.5-8.0 for MC1R)

Challenge: Poor Functional Activity

  • Solution: Verify proper protein folding using circular dichroism

  • Solution: Assess ligand binding capability immediately after purification

  • Solution: Reconstitute in lipid nanodiscs to maintain native conformation

  • Solution: Use detergent screening to identify optimal solubilization conditions

Challenge: Batch-to-Batch Variability

  • Solution: Standardize production protocols with detailed SOPs

  • Solution: Implement quality control metrics (SDS-PAGE, Western blot, activity assays)

  • Solution: Prepare large, homogeneous batches when possible

  • Solution: Include internal standards for activity normalization

Implementing these solutions systematically can significantly improve the yield, quality, and functionality of recombinant L. chrysopygus MC1R protein.

How can researchers validate the functional activity of recombinant L. chrysopygus MC1R?

To conclusively validate the functional activity of recombinant L. chrysopygus MC1R, researchers should implement a multi-level validation strategy:

Level 1: Structural Integrity Validation

  • Perform SDS-PAGE and Western blot analysis to confirm protein size and purity (>90%)

  • Assess secondary structure using circular dichroism spectroscopy

  • Evaluate thermal stability using differential scanning fluorimetry

  • Verify glycosylation status using glycosidase treatments and mobility shift assays

Level 2: Ligand Binding Validation

  • Conduct saturation binding assays with radiolabeled α-MSH

  • Perform competition binding assays with known MC1R ligands

  • Compare binding parameters (Kd, Bmax) with those of well-characterized MC1R proteins

  • Assess binding specificity using related melanocortin peptides (β-MSH, ACTH)

Level 3: Signaling Pathway Validation

  • Measure cAMP production following agonist stimulation

  • Compare EC50 values with reference MC1R proteins

  • Confirm signal inhibition using selective antagonists

  • Demonstrate G-protein coupling using GTPγS binding assays

Level 4: Cellular Response Validation

  • Express recombinant MC1R in melanocyte cell lines

  • Measure melanin production following receptor activation

  • Assess melanocyte dendrite formation and other morphological changes

  • Demonstrate receptor internalization following agonist binding

Level 5: Comparative Validation

  • Compare activity parameters with those of MC1R from related species

  • Correlate functional differences with sequence variations

  • Relate functional properties to known coat color phenotypes

This comprehensive validation approach ensures that the recombinant L. chrysopygus MC1R accurately represents the native receptor's properties and provides a solid foundation for subsequent experimental applications.

How can CRISPR/Cas9 technology be utilized to study MC1R function in Leontopithecus species?

CRISPR/Cas9 technology offers powerful approaches for investigating MC1R function in Leontopithecus species, though such studies would require careful ethical considerations given the endangered status of these primates. Alternative approaches using cell culture models include:

Cell Line Engineering:

  • Design guide RNAs targeting conserved regions of primate MC1R

  • Create knockout cell lines by introducing frameshift mutations

  • Generate knock-in cell lines expressing Leontopithecus-specific MC1R variants

  • Develop isogenic cell lines differing only in specific MC1R mutations

Functional Domain Analysis:

  • Create precise mutations in key functional domains identified from comparative sequence analysis

  • Generate truncation mutants to identify essential regions for signaling

  • Introduce species-specific substitutions to identify those responsible for phenotypic differences

  • Create chimeric receptors combining domains from different species

Signaling Pathway Investigation:

  • Simultaneously edit MC1R and downstream effectors to identify epistatic interactions

  • Create reporter cell lines with CRISPR-modified endogenous response elements

  • Perform CRISPR screens to identify novel components of the MC1R signaling pathway

  • Use CRISPRa/CRISPRi to modulate expression levels of MC1R and interacting proteins

Methodological Approach:

  • Isolate primary fibroblasts from Leontopithecus species (with appropriate permits)

  • Reprogram to induced pluripotent stem cells (iPSCs)

  • Differentiate to melanocytes while introducing MC1R modifications

  • Analyze resulting changes in melanin production and distribution

These approaches would provide unprecedented insights into the molecular mechanisms by which MC1R variations contribute to the distinctive coat coloration patterns observed across Leontopithecus species.

What are the implications of MC1R research in Leontopithecus for conservation genetics?

MC1R research in Leontopithecus species has significant implications for conservation genetics efforts:

Genetic Diversity Assessment:

  • MC1R sequence variations can serve as markers for population genetic diversity

  • The degree of polymorphism in MC1R reflects historical population bottlenecks

  • Comparing MC1R diversity across populations helps identify genetically distinct units for conservation

Adaptation and Selection:

  • Patterns of selection on MC1R (purifying, positive, or relaxed) provide insights into evolutionary history

  • Unique MC1R variants may represent adaptations to specific environmental conditions

  • Understanding selection pressures helps predict population resilience to environmental changes

Hybridization Detection:

  • Species-specific MC1R variants can serve as genetic markers for hybridization

  • Introgression of MC1R alleles between species can be monitored in contact zones

  • Hybrid identification is crucial for maintaining genetic integrity in reintroduction programs

Functional Conservation Genomics:

  • Correlating MC1R genotypes with phenotypes helps preserve functional genetic diversity

  • Understanding the genetic basis of coat color assists in managing breeding programs

  • Preserving adaptive genetic variation enhances long-term population viability

Given that all Leontopithecus species are endangered, with L. chrysopygus being critically endangered, MC1R research provides valuable molecular markers for conservation management while also offering insights into the evolutionary processes that have shaped these unique primates. Studies suggest that purifying selection is the primary mode of evolution for the MC1R gene in nonhuman primates, with specific exceptions like L. rosalia showing potential relaxation of selection .

How does the evolution of MC1R in Leontopithecus compare with other primate lineages?

The evolution of MC1R in Leontopithecus represents an intriguing case study in primate molecular evolution:

Evolutionary Rate Comparison:

Primate GroupSelection PatterndN/dS RatioNotable Features
Leontopithecus (lion tamarins)Mixed; purifying with species-specific exceptionsVariable; up to 0.91 in L. rosaliaFunctional modifications potentially linked to distinctive coat colors
Other Callitrichidae (marmosets, tamarins)Predominantly purifyingGenerally <0.5Fewer nonsynonymous mutations
Lorisidae (lorises, galagos)Strong purifying0.091275 variable nucleotides with 18 nonsynonymous substitutions
Catarrhines (Old World monkeys, apes)Strong purifyingGenerally <0.3High functional conservation
Homo (humans)Relaxed constraint in some populationsVariableMultiple functional variants associated with red hair, fair skin

Molecular Signatures:

  • Leontopithecus species show unique patterns of nonsynonymous substitutions compared to other primates

  • The elevated dN/dS ratio in L. rosalia (0.91) suggests potential relaxation of selective constraints

  • The distribution of substitutions across functional domains differs between Leontopithecus and other primate groups

  • Parallel evolution may have occurred in certain lineages with similar coat color adaptations

Functional Implications:

  • The distinctive coat colors in Leontopithecus likely result from species-specific MC1R variants

  • Unlike in Lorisidae, where aposematic coloration evolved without MC1R changes , Leontopithecus shows evidence of MC1R-mediated color evolution

  • The molecular basis of regionalized coloration (e.g., golden head in L. chrysomelas) likely involves complex regulatory mechanisms beyond simple MC1R coding variants

This comparative evolutionary analysis provides valuable insights into the diverse mechanisms by which primates have evolved their distinctive coat coloration patterns, with Leontopithecus representing a particularly interesting case of potential adaptive MC1R evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.