Recombinant Leontopithecus rosalia Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant MC1R from Leontopithecus rosalia (golden lion tamarin) is produced in E. coli with an N-terminal His-tag for purification. Key specifications include:

PropertyDetail
SpeciesLeontopithecus rosalia (Golden lion tamarin)
SourceE. coli expression system
Protein LengthFull-length (1–310 amino acids)
SequenceMPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENLVVVAAIAKNRNLHSSMYCFICCLAL...
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

This recombinant protein retains native structural features, including extracellular loops critical for ligand binding and intracellular domains for G-protein coupling .

Functional Significance

MC1R regulates melanogenesis through cAMP-PKA signaling, impacting eumelanin (brown/black) vs. pheomelanin (red/yellow) synthesis. Key findings:

  • Ligand Binding: Binds α-MSH and ACTH with high affinity, activating adenylyl cyclase to elevate intracellular cAMP .

  • Desensitization: GRK6 phosphorylates C-terminal residues (T308, S316), enabling β-arrestin-2-mediated internalization .

  • Evolutionary Adaptation: In Leontopithecus rosalia, nonsynonymous MC1R mutations correlate with coat color variation, though purifying selection dominates in most primates .

Comparative Genomics

Studies on Leontopithecus species reveal:

  • Coat Color Variants: L. rosalia exhibits higher MC1R dN/dS ratios (0.91) compared to other primates, suggesting relaxed selection or adaptive evolution in pigmentation .

  • Functional Mutations: Deleterious substitutions (e.g., Q864I1 in L. chrysomelas) alter receptor trafficking or ligand affinity, potentially explaining interspecies color differences .

Research Applications

Recombinant L. rosalia MC1R is utilized in:

  • Ligand Binding Assays: Testing synthetic melanocortins or antagonists .

  • Signaling Studies: Quantifying cAMP production in melanocyte models .

  • Evolutionary Studies: Comparing receptor function across primates to infer adaptive mechanisms .

Challenges and Future Directions

  • Protein Stability: Lyophilized MC1R requires careful reconstitution to avoid aggregation .

  • Species-Specificity: Functional differences between primate MC1R orthologs complicate cross-species extrapolation .

  • Therapeutic Potential: Insights from L. rosalia MC1R could inform treatments for melanoma or vitiligo, given conserved signaling pathways .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Leontopithecus rosalia (Golden lion tamarin)
Target Names
Target Protein Sequence
MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGVLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFI TYYDHAAVLLCLMVFFLAMLVLMAVLYVHMLARARQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRMLKEVLGRGRW
Uniprot No.

Target Background

Function
This receptor is responsible for binding to melanocyte-stimulating hormone (MSH) isoforms (alpha, beta, and gamma) as well as adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins, which activate adenylate cyclase. This receptor plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of MC1R in Leontopithecus species? (Basic)

MC1R (Melanocyte-stimulating hormone receptor) in Leontopithecus species is a G-protein coupled receptor (GPCR) with seven α-helical transmembrane (TM) domains. The human MC1R, which shares structural similarities with primate MC1Rs, consists of 317 amino acids . The receptor features:

  • N-linked glycosylation site at the external N-terminus

  • Palmitoylation site at the intracellular C-terminus

  • DRY motif at the junction of the third TM domain

  • Extracellular and intracellular loops (els and ils) between transmembrane domains

Unlike many GPCRs, MC1R lacks specific cysteine residues in the first and second extracellular domains, and the fourth and fifth TM domains lack proline . The extracellular N-terminal tail functions as a signal anchor and is crucial for ligand affinity, while the C-terminus plays roles in G protein interactions, protein trafficking, desensitization, and internalization .

How does MC1R signaling function at the molecular level? (Advanced)

MC1R signaling involves a complex cascade initiated by ligand binding. When α-MSH (alpha-Melanocyte Stimulating Hormone) binds to MC1R, it triggers the following molecular events:

  • Activation of adenylyl cyclase through G protein coupling

  • Production of intracellular cAMP

  • Activation of protein kinases C and A

  • Subsequent activation of MAPK and JAK-STAT pathways

These pathways lead to:

  • Prevention of IκB degradation

  • Activation of CREB (a transcription factor)

  • Regulation of anti-inflammatory mediators including IB and IL-10

  • Enhanced levels of cytoplasmic IκB

  • Inhibition of pro-inflammatory genes (IL-1, TNF-α, IL-6, IL-8, IL-12, iNOS)

  • Reduction in adhesion molecules (ICAM-1, VCAM-1, and MMPs)

Recent structural studies using Cryo-electron microscopy have determined the structure of MC1R–Gs complexes bound to endogenous hormone α-MSH, the drug afamelanotide, and synthetic agonists like SHU9119, providing insights into ligand binding mechanisms .

What expression systems are optimal for producing recombinant Leontopithecus MC1R protein? (Basic)

For recombinant MC1R production from Leontopithecus species, E. coli has been successfully employed as an expression system, as evidenced by the production of recombinant Leontopithecus chrysomelas MC1R . The methodology involves:

  • Expression construct design: Full-length MC1R coding sequence (typically 1-310 amino acids) with an N-terminal His tag for purification

  • Expression conditions: Optimization of temperature, induction parameters, and culture media

  • Protein extraction and purification: Using affinity chromatography with His-tag binding columns

  • Quality control: Verification of purity (>90%) by SDS-PAGE

The resulting protein is typically prepared as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and recommendations include reconstituting to 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol for long-term storage .

What are the critical factors to consider when designing functional assays for recombinant MC1R? (Advanced)

When designing functional assays for recombinant Leontopithecus MC1R, researchers should consider:

  • Receptor activation measurements:

    • cAMP accumulation assays to measure G protein coupling efficiency

    • Calcium flux assays where applicable

    • ERK1/2 phosphorylation to assess MAPK pathway activation

  • Ligand binding parameters:

    • Competitive binding assays with labeled α-MSH or synthetic ligands

    • Determination of binding kinetics (kon, koff) and affinity (Kd)

    • Evaluation of EC50 values for different ligands (compare to human MC1R where EC50 values like 28 ± 12 nM have been reported for certain agonists)

  • Downstream signaling assessments:

    • Measurement of anti-inflammatory mediator production

    • Quantification of effects on gene expression using qPCR

    • Evaluation of protein kinase activation

  • Receptor trafficking studies:

    • Internalization assays to assess receptor cycling

    • Fluorescent tagging to visualize subcellular localization

    • Phosphorylation state analysis to understand receptor regulation

When planning these assays, controls should include known MC1R ligands and comparison with human MC1R responses to establish functional conservation or divergence between species.

How does MC1R expression vary across normal and pathological tissues? (Basic)

MC1R expression shows distinct patterns across tissues and disease states:

Normal tissues:

  • Melanocytes express approximately 700 MC1R protein units per cell

  • Normal brain cells express detectable amounts

  • Some expression in granulocytes

  • Generally low expression in most other normal human tissues

Pathological tissues:

  • Higher expression levels in melanoma cells compared to normal melanocytes

  • Expression increases in a stepwise manner during melanoma progression:

    • Benign nevi (lowest)

    • Primary melanoma (intermediate)

    • Metastatic melanoma (highest)

  • Higher expression is observed in deeper primary lesions (>1 mm)

  • Ulcerated lesions show increased expression

  • Mucosal melanomas display higher expression than cutaneous melanomas

These expression patterns suggest MC1R as a potential biomarker for melanoma progression and aggression.

What methodologies provide the most reliable quantification of MC1R expression in tissue samples? (Advanced)

For reliable quantification of MC1R expression in tissue samples, researchers should consider:

  • Quantitative immunofluorescence:

    • Allows precise measurement of expression intensity

    • Enables detection of subtle differences not discernable by standard IHC

    • Particularly valuable for establishing expression thresholds relevant to therapeutic targeting

  • Immunohistochemistry (IHC) with digital analysis:

    • Permits spatial localization within tissue architecture

    • Can be combined with multiple markers to assess co-expression

    • Antibody selection is critical; studies have validated specific epitopes of MC1R

  • Tissue microarrays:

    • Enable high-throughput analysis across multiple samples

    • Studies have successfully used this approach with cohorts containing hundreds of specimens (e.g., 225 benign nevi, 189 primary melanomas, 271 metastatic melanomas)

  • Molecular quantification methods:

    • RT-qPCR for mRNA expression analysis

    • Digital droplet PCR for absolute quantification

    • RNA-Seq for transcriptomic profiling

When implementing these methods, researchers should address potential confounders including antibody specificity, epitope accessibility, and tissue processing variables. Multi-method validation is recommended for definitive quantification.

How is MC1R conserved across primates and other mammals? (Basic)

MC1R shows interesting patterns of conservation and divergence across species:

  • Sequence conservation: The coding sequence (945 bp in mice) is moderately conserved across mammalian species, with functional domains showing higher conservation than variable regions

  • Evolutionary rates: Studies comparing Mus (rodents) and mustelids (Carnivora) showed different evolutionary constraints:

    • Mus species have a dN/dS ratio (ω) of 0.19

    • Mustelids have a higher dN/dS ratio of 0.35 (using likelihood-based one-ratio model with empirical codon frequencies)

  • Codon usage bias: Stronger codon usage bias has been observed in mustelids compared to Mus species. When estimated with equal codon frequencies, the dN/dS ratio dramatically increased to 1.02 for mustelids but only to 0.31 for Mus

  • Adaptive evolution: Accelerated rates of amino acid replacement (omega approaching 1) have been observed in certain lineages, particularly in ancestral subgeneric lineages of Mus, potentially associated with ecological niche shifting

These patterns suggest that both functional constraints on coat color variation and selective constraints on codon usage bias have influenced MC1R evolution, with differential effects across mammalian lineages.

What analytical approaches best identify selective pressures on MC1R across primate lineages? (Advanced)

To identify selective pressures on MC1R across primate lineages, including Leontopithecus species, researchers should employ multiple complementary analytical approaches:

  • Likelihood-based selection analysis:

    • Implement models that allow ω (dN/dS ratio) to vary across lineages (free-ratio model)

    • Apply branch-site models to detect episodic selection on specific branches

    • Compare single-ratio, two-ratio, and free-ratio models using likelihood ratio tests

  • Codon usage bias analysis:

    • Calculate codon adaptation index (CAI)

    • Compare models with empirical versus equal codon frequencies

    • Assess effective number of codons (ENC) across species

  • Functional domain analysis:

    • Partition the gene into functional domains (transmembrane, intracellular, extracellular)

    • Analyze selective pressures separately for each domain

    • Identify domain-specific constraints

  • Ancestral sequence reconstruction:

    • Infer ancestral MC1R sequences at key nodes in the primate phylogeny

    • Calculate branch-specific substitution rates

    • Identify lineage-specific amino acid changes

  • Population genetics approaches:

    • Analyze patterns of polymorphism within species

    • Apply McDonald-Kreitman tests to distinguish adaptive from neutral evolution

    • Assess Tajima's D and other neutrality tests

When implementing these approaches, researchers should account for phylogenetic uncertainty, ensure adequate taxon sampling (particularly within Leontopithecus and related genera), and consider the potential confounding effects of recombination and gene conversion.

What is the role of MC1R in melanoma progression and prognosis? (Basic)

MC1R plays significant roles in melanoma progression and serves as a prognostic marker:

These findings highlight MC1R as a valuable biomarker for identifying aggressive melanoma and potentially guiding adjuvant therapy decisions.

What therapeutic approaches target MC1R, and how can they be optimized for clinical applications? (Advanced)

Several therapeutic approaches targeting MC1R are under development with promising results:

  • Radiopharmaceutical approaches:

    • Alpha-particle emitting therapy using [225Ac]Ac-DOTA-MC1RL showed significantly prolonged survival and tumor growth delay in uveal melanoma xenografts

    • These treatments demonstrated low in vivo toxicity

    • Alpha-emitting particles remodel the tumor microenvironment, increasing fractions of M1 macrophages, Th1 helper cells, and activated natural killer cells

  • Immunotherapeutic strategies:

    • MC1R-derived peptides induce responses from cytotoxic T lymphocytes (CTL) and tumor infiltrating lymphocytes (TIL)

    • This suggests potential for MC1R-targeted melanoma therapeutic vaccines

    • Combinations of alpha-particle therapy and immunotherapy may enhance treatment efficacy

  • Small molecule agonists:

    • Compounds like BMS-470539 show selectivity for MC1R

    • EC50 value for MC1R of BMS-470539 is 28 ± 12 nM

    • This compound demonstrates limited activation of MC3R and reduced selectivity for MC4R and MC5R compared to MC1R

  • Imaging and theranostic applications:

    • Antibodies, antibody fragments, engineered proteins, and peptides can be developed to bind with high affinity to MC1R

    • These can be labeled with radionuclides for noninvasive imaging using PET or SPECT

    • Such imaging agents do not typically cross the blood-brain barrier, limiting uptake in normal brain cells

    • Noninvasive imaging of MC1R has potential to guide clinical treatment decisions

Optimization strategies include:

  • Patient selection based on MC1R expression levels using quantitative imaging

  • Combination approaches with immunotherapy to enhance tumor microenvironment modulation

  • Development of more selective MC1R agonists based on recent structural insights from Cryo-EM studies

  • Theranostic approaches that combine imaging and therapeutic functions

How do MC1R variants affect cancer susceptibility and phenotypic traits? (Basic)

MC1R variants have been associated with various cancer susceptibilities and phenotypic traits:

  • Non-melanoma skin cancer (NMSC):

    • Studies have evaluated the association between MC1R variants and NMSC risk

    • Statistical analyses have shown correlations between specific variants and cancer development

    • These associations have been assessed using logistic regression models adjusting for factors including age, sex, sun exposure, sunburns, and smoking status

  • Melanoma risk:

    • MC1R variants have been linked to heightened skin cancer susceptibility

    • Variants serve as prognostic markers in metastatic melanoma and colorectal cancer

    • Impaired MC1R function correlates with increased cancer risk

  • Phenotypic associations:

    • MC1R plays a critical role in human pigmentation

    • Variants influence coat color determination in mammals

    • Functional constraints on coat color variation have participated in structuring MC1R gene sequences

These findings highlight the dual role of MC1R variants in both normal phenotypic variation and pathological processes, making them important targets for genetic analysis in cancer risk assessment.

What statistical methods are most appropriate for analyzing MC1R variant associations with disease outcomes? (Advanced)

For robust analysis of MC1R variant associations with disease outcomes, researchers should employ these statistical approaches:

  • Meta-analytic methods:

    • Pool data across studies using DerSimonian–Laird random-effects models

    • Calculate odds ratios (ORs) with 95% confidence intervals

    • Assess heterogeneity using Q-statistic and I2 percentage

    • Apply van Houwelingen's multivariate approach when analyzing correlated ORs

    • Test for small-study effects using funnel plots and Egger's test

  • Regression models with appropriate covariates:

    • Implement logistic regression adjusting for key confounders:

      • Age

      • Sex

      • Intermittent and chronic sun exposure

      • Lifetime and childhood sunburns

      • Smoking status

    • Handle missing data using multiple imputation models for variables with limited missing values

  • Hardy-Weinberg equilibrium assessment:

    • Verify departure of MC1R variant frequencies from Hardy-Weinberg equilibrium expectations

    • Apply χ2-tests in control groups for each study

    • Use as a quality control metric for genotyping accuracy

  • Sensitivity and subgroup analyses:

    • Perform meta-regression by:

      • Year of publication

      • Geographic area

      • Genotyping methodology

      • Deviation from Hardy-Weinberg equilibrium

      • Type of controls

      • DNA source

    • Conduct stratified analyses by cancer subtype (e.g., BCC vs. SCC)

  • Validation approaches:

    • Compare pooled odds ratios from primary datasets with meta-odds ratios calculated from published risk estimates

    • Assess robustness of findings across different analytical methods and data sources

These methods provide comprehensive analysis frameworks that account for heterogeneity, confounding, and potential biases in MC1R variant association studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.