Recombinant MC1R from Leontopithecus rosalia (golden lion tamarin) is produced in E. coli with an N-terminal His-tag for purification. Key specifications include:
| Property | Detail |
|---|---|
| Species | Leontopithecus rosalia (Golden lion tamarin) |
| Source | E. coli expression system |
| Protein Length | Full-length (1–310 amino acids) |
| Sequence | MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPDGLFLSLGLVSLVENLVVVAAIAKNRNLHSSMYCFICCLAL... |
| Purity | >90% (SDS-PAGE verified) |
| Storage | Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C |
| Reconstitution | 0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage |
This recombinant protein retains native structural features, including extracellular loops critical for ligand binding and intracellular domains for G-protein coupling .
MC1R regulates melanogenesis through cAMP-PKA signaling, impacting eumelanin (brown/black) vs. pheomelanin (red/yellow) synthesis. Key findings:
Ligand Binding: Binds α-MSH and ACTH with high affinity, activating adenylyl cyclase to elevate intracellular cAMP .
Desensitization: GRK6 phosphorylates C-terminal residues (T308, S316), enabling β-arrestin-2-mediated internalization .
Evolutionary Adaptation: In Leontopithecus rosalia, nonsynonymous MC1R mutations correlate with coat color variation, though purifying selection dominates in most primates .
Studies on Leontopithecus species reveal:
Coat Color Variants: L. rosalia exhibits higher MC1R dN/dS ratios (0.91) compared to other primates, suggesting relaxed selection or adaptive evolution in pigmentation .
Functional Mutations: Deleterious substitutions (e.g., Q864I1 in L. chrysomelas) alter receptor trafficking or ligand affinity, potentially explaining interspecies color differences .
Recombinant L. rosalia MC1R is utilized in:
Ligand Binding Assays: Testing synthetic melanocortins or antagonists .
Signaling Studies: Quantifying cAMP production in melanocyte models .
Evolutionary Studies: Comparing receptor function across primates to infer adaptive mechanisms .
Protein Stability: Lyophilized MC1R requires careful reconstitution to avoid aggregation .
Species-Specificity: Functional differences between primate MC1R orthologs complicate cross-species extrapolation .
Therapeutic Potential: Insights from L. rosalia MC1R could inform treatments for melanoma or vitiligo, given conserved signaling pathways .
MC1R (Melanocyte-stimulating hormone receptor) in Leontopithecus species is a G-protein coupled receptor (GPCR) with seven α-helical transmembrane (TM) domains. The human MC1R, which shares structural similarities with primate MC1Rs, consists of 317 amino acids . The receptor features:
N-linked glycosylation site at the external N-terminus
Palmitoylation site at the intracellular C-terminus
DRY motif at the junction of the third TM domain
Extracellular and intracellular loops (els and ils) between transmembrane domains
Unlike many GPCRs, MC1R lacks specific cysteine residues in the first and second extracellular domains, and the fourth and fifth TM domains lack proline . The extracellular N-terminal tail functions as a signal anchor and is crucial for ligand affinity, while the C-terminus plays roles in G protein interactions, protein trafficking, desensitization, and internalization .
MC1R signaling involves a complex cascade initiated by ligand binding. When α-MSH (alpha-Melanocyte Stimulating Hormone) binds to MC1R, it triggers the following molecular events:
Activation of adenylyl cyclase through G protein coupling
Production of intracellular cAMP
Activation of protein kinases C and A
These pathways lead to:
Prevention of IκB degradation
Activation of CREB (a transcription factor)
Regulation of anti-inflammatory mediators including IB and IL-10
Enhanced levels of cytoplasmic IκB
Inhibition of pro-inflammatory genes (IL-1, TNF-α, IL-6, IL-8, IL-12, iNOS)
Recent structural studies using Cryo-electron microscopy have determined the structure of MC1R–Gs complexes bound to endogenous hormone α-MSH, the drug afamelanotide, and synthetic agonists like SHU9119, providing insights into ligand binding mechanisms .
For recombinant MC1R production from Leontopithecus species, E. coli has been successfully employed as an expression system, as evidenced by the production of recombinant Leontopithecus chrysomelas MC1R . The methodology involves:
Expression construct design: Full-length MC1R coding sequence (typically 1-310 amino acids) with an N-terminal His tag for purification
Expression conditions: Optimization of temperature, induction parameters, and culture media
Protein extraction and purification: Using affinity chromatography with His-tag binding columns
The resulting protein is typically prepared as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and recommendations include reconstituting to 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol for long-term storage .
When designing functional assays for recombinant Leontopithecus MC1R, researchers should consider:
Receptor activation measurements:
cAMP accumulation assays to measure G protein coupling efficiency
Calcium flux assays where applicable
ERK1/2 phosphorylation to assess MAPK pathway activation
Ligand binding parameters:
Downstream signaling assessments:
Measurement of anti-inflammatory mediator production
Quantification of effects on gene expression using qPCR
Evaluation of protein kinase activation
Receptor trafficking studies:
Internalization assays to assess receptor cycling
Fluorescent tagging to visualize subcellular localization
Phosphorylation state analysis to understand receptor regulation
When planning these assays, controls should include known MC1R ligands and comparison with human MC1R responses to establish functional conservation or divergence between species.
MC1R expression shows distinct patterns across tissues and disease states:
Melanocytes express approximately 700 MC1R protein units per cell
Normal brain cells express detectable amounts
Some expression in granulocytes
Higher expression levels in melanoma cells compared to normal melanocytes
Expression increases in a stepwise manner during melanoma progression:
Higher expression is observed in deeper primary lesions (>1 mm)
Ulcerated lesions show increased expression
Mucosal melanomas display higher expression than cutaneous melanomas
These expression patterns suggest MC1R as a potential biomarker for melanoma progression and aggression.
For reliable quantification of MC1R expression in tissue samples, researchers should consider:
Quantitative immunofluorescence:
Immunohistochemistry (IHC) with digital analysis:
Tissue microarrays:
Molecular quantification methods:
RT-qPCR for mRNA expression analysis
Digital droplet PCR for absolute quantification
RNA-Seq for transcriptomic profiling
When implementing these methods, researchers should address potential confounders including antibody specificity, epitope accessibility, and tissue processing variables. Multi-method validation is recommended for definitive quantification.
MC1R shows interesting patterns of conservation and divergence across species:
Sequence conservation: The coding sequence (945 bp in mice) is moderately conserved across mammalian species, with functional domains showing higher conservation than variable regions
Evolutionary rates: Studies comparing Mus (rodents) and mustelids (Carnivora) showed different evolutionary constraints:
Codon usage bias: Stronger codon usage bias has been observed in mustelids compared to Mus species. When estimated with equal codon frequencies, the dN/dS ratio dramatically increased to 1.02 for mustelids but only to 0.31 for Mus
Adaptive evolution: Accelerated rates of amino acid replacement (omega approaching 1) have been observed in certain lineages, particularly in ancestral subgeneric lineages of Mus, potentially associated with ecological niche shifting
These patterns suggest that both functional constraints on coat color variation and selective constraints on codon usage bias have influenced MC1R evolution, with differential effects across mammalian lineages.
To identify selective pressures on MC1R across primate lineages, including Leontopithecus species, researchers should employ multiple complementary analytical approaches:
Likelihood-based selection analysis:
Codon usage bias analysis:
Functional domain analysis:
Partition the gene into functional domains (transmembrane, intracellular, extracellular)
Analyze selective pressures separately for each domain
Identify domain-specific constraints
Ancestral sequence reconstruction:
Infer ancestral MC1R sequences at key nodes in the primate phylogeny
Calculate branch-specific substitution rates
Identify lineage-specific amino acid changes
Population genetics approaches:
Analyze patterns of polymorphism within species
Apply McDonald-Kreitman tests to distinguish adaptive from neutral evolution
Assess Tajima's D and other neutrality tests
When implementing these approaches, researchers should account for phylogenetic uncertainty, ensure adequate taxon sampling (particularly within Leontopithecus and related genera), and consider the potential confounding effects of recombination and gene conversion.
MC1R plays significant roles in melanoma progression and serves as a prognostic marker:
These findings highlight MC1R as a valuable biomarker for identifying aggressive melanoma and potentially guiding adjuvant therapy decisions.
Several therapeutic approaches targeting MC1R are under development with promising results:
Radiopharmaceutical approaches:
Alpha-particle emitting therapy using [225Ac]Ac-DOTA-MC1RL showed significantly prolonged survival and tumor growth delay in uveal melanoma xenografts
These treatments demonstrated low in vivo toxicity
Alpha-emitting particles remodel the tumor microenvironment, increasing fractions of M1 macrophages, Th1 helper cells, and activated natural killer cells
Immunotherapeutic strategies:
Small molecule agonists:
Imaging and theranostic applications:
Antibodies, antibody fragments, engineered proteins, and peptides can be developed to bind with high affinity to MC1R
These can be labeled with radionuclides for noninvasive imaging using PET or SPECT
Such imaging agents do not typically cross the blood-brain barrier, limiting uptake in normal brain cells
Noninvasive imaging of MC1R has potential to guide clinical treatment decisions
Optimization strategies include:
Patient selection based on MC1R expression levels using quantitative imaging
Combination approaches with immunotherapy to enhance tumor microenvironment modulation
Development of more selective MC1R agonists based on recent structural insights from Cryo-EM studies
Theranostic approaches that combine imaging and therapeutic functions
MC1R variants have been associated with various cancer susceptibilities and phenotypic traits:
Non-melanoma skin cancer (NMSC):
Studies have evaluated the association between MC1R variants and NMSC risk
Statistical analyses have shown correlations between specific variants and cancer development
These associations have been assessed using logistic regression models adjusting for factors including age, sex, sun exposure, sunburns, and smoking status
Melanoma risk:
Phenotypic associations:
These findings highlight the dual role of MC1R variants in both normal phenotypic variation and pathological processes, making them important targets for genetic analysis in cancer risk assessment.
For robust analysis of MC1R variant associations with disease outcomes, researchers should employ these statistical approaches:
Meta-analytic methods:
Pool data across studies using DerSimonian–Laird random-effects models
Calculate odds ratios (ORs) with 95% confidence intervals
Assess heterogeneity using Q-statistic and I2 percentage
Apply van Houwelingen's multivariate approach when analyzing correlated ORs
Test for small-study effects using funnel plots and Egger's test
Regression models with appropriate covariates:
Hardy-Weinberg equilibrium assessment:
Sensitivity and subgroup analyses:
Validation approaches:
These methods provide comprehensive analysis frameworks that account for heterogeneity, confounding, and potential biases in MC1R variant association studies.