Recombinant Lepidium virginicum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Lepidium virginicum (Virginia pepperweed)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Lepidium virginicum?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Lepidium virginicum (Virginia pepperweed). In its mature form, the protein spans amino acids 36-320 and functions as an electron carrier in photosynthesis, facilitating electron transfer between photosystem II and photosystem I. The protein contains heme groups that are essential for its electron transport function, and the "apo" form refers to the protein before heme attachment .

How does recombinant Lepidium virginicum Apocytochrome f compare to the native protein?

The recombinant version available for research contains the full-length mature protein (amino acids 36-320) fused to an N-terminal His tag. While the core structure maintains the functional domains of the native protein, the His tag addition facilitates purification using affinity chromatography. Researchers should consider that the His tag may influence certain protein properties, including solubility and potentially some protein-protein interactions, though the core functional domains remain intact. Expression in E. coli means the protein lacks plant-specific post-translational modifications that might be present in the native form .

What are the optimal conditions for expressing Recombinant Lepidium virginicum Apocytochrome f in E. coli?

For optimal expression in E. coli, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with strong inducible promoters (T7, tac)

  • E. coli strain: BL21(DE3) or Rosetta strains are recommended for membrane proteins

  • Culture conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Induction with 0.5-1.0 mM IPTG

    • Post-induction temperature reduction to 16-18°C for 16-20 hours to enhance proper folding

  • Media supplementation: Consider adding 5-aminolevulinic acid (precursor for heme biosynthesis) to enhance functional protein production

These conditions help balance protein yield with proper folding, as cytochrome proteins can form inclusion bodies when overexpressed .

What purification strategies are most effective for obtaining high-purity Recombinant Lepidium virginicum Apocytochrome f?

A multi-step purification protocol yields the highest purity preparations:

  • Initial extraction: Lyse cells using sonication or French press in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Affinity chromatography: Utilize Ni-NTA resin to capture the His-tagged protein

    • Binding buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 10 mM imidazole

    • Wash buffer: Same as binding buffer but with 20-30 mM imidazole

    • Elution buffer: Same as binding buffer but with 250-300 mM imidazole

  • Size exclusion chromatography: Further purify using a Superdex 75 or 200 column to separate aggregates and contaminants

  • Optional ion exchange: For highest purity, consider a final polishing step using anion exchange chromatography

This approach typically yields protein with >90% purity suitable for structural and functional studies .

What are the recommended storage conditions to maintain stability of purified Recombinant Lepidium virginicum Apocytochrome f?

For optimal stability of the purified protein:

  • Short-term storage (up to one week):

    • Store at 4°C in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

  • Long-term storage:

    • Lyophilize the protein or store in solution at -20°C/-80°C with 50% glycerol

    • Aliquot to avoid repeated freeze-thaw cycles

    • Prior to opening, briefly centrifuge vials to bring contents to the bottom

  • Reconstitution protocol:

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for extended stability

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided .

How can researchers assess the functional integrity of Recombinant Lepidium virginicum Apocytochrome f?

Functional assessment should incorporate multiple complementary approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to confirm proper heme incorporation (characteristic peaks at ~420 nm and ~550 nm)

    • Circular dichroism to verify secondary structure integrity

  • Electron transfer assays:

    • Measure redox potential using cyclic voltammetry

    • Perform electron transfer kinetics with artificial electron donors/acceptors

  • Binding studies:

    • Analyze interaction with plastocyanin using surface plasmon resonance

    • Isothermal titration calorimetry to determine binding constants

  • Structural verification:

    • Limited proteolysis to confirm proper folding

    • Thermal shift assays to assess protein stability

These methods collectively provide a comprehensive assessment of both structural integrity and functional capacity .

What experimental approaches can be used to study electron transfer properties of Recombinant Lepidium virginicum Apocytochrome f?

Electron transfer studies require specialized methodologies:

  • Steady-state kinetics:

    • Measure electron transfer rates using stopped-flow spectroscopy

    • Monitor absorbance changes at specific wavelengths corresponding to redox state transitions

  • Transient absorption spectroscopy:

    • Use laser flash photolysis to trigger electron transfer events

    • Capture ultrafast electron movement on microsecond to picosecond timescales

  • Electrochemical methods:

    • Protein film voltammetry on modified electrodes

    • Measure midpoint potentials and electron transfer rates

  • Computational approaches:

    • Molecular dynamics simulations to identify electron transfer pathways

    • Quantum mechanical calculations of reorganization energies

These techniques provide detailed insights into the electron transfer mechanism and efficiency .

How does Recombinant Lepidium virginicum Apocytochrome f interact with other components of the photosynthetic electron transport chain?

Interaction studies should employ these methodological approaches:

  • Reconstitution experiments:

    • Incorporate purified apocytochrome f into liposomes with other purified components

    • Measure electron transfer rates in the reconstituted system

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with plastocyanin or cytochrome b6

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Fluorescence resonance energy transfer (FRET) to measure interaction dynamics

  • Structural analysis:

    • Cryo-electron microscopy of assembled complexes

    • X-ray crystallography of co-crystals with binding partners

  • Mutagenesis approaches:

    • Generate site-specific mutations at predicted interaction interfaces

    • Measure effects on binding affinity and electron transfer kinetics

These approaches collectively map the interaction landscape and functional coupling between components .

How does Lepidium virginicum Apocytochrome f compare structurally and functionally to homologs from other plant species?

Comparative analysis reveals important evolutionary and functional insights:

SpeciesSequence Identity (%)Key Structural DifferencesFunctional Implications
Vicia faba~85-90%Minor variations in surface loopsSimilar electron transfer properties
Oenothera hookeri~80-85%Differences in charged residues at plastocyanin binding siteAltered binding kinetics with plastocyanin
Spinacia oleracea~75-80%Variations in heme pocket residuesSlightly different redox potential
Chlamydomonas reinhardtii~60-65%Extended loop regionsAdapted for algal-specific interactions

These differences provide research opportunities for structure-function studies and evolutionary analysis of electron transport systems across plant lineages .

What advanced experimental techniques are being developed for studying Recombinant Lepidium virginicum Apocytochrome f in photosynthesis research?

Cutting-edge methodologies are expanding research capabilities:

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes during electron transfer

    • Atomic force microscopy to study membrane integration and complex assembly

  • Advanced spectroscopy:

    • Ultra-fast transient absorption spectroscopy on femtosecond timescales

    • Two-dimensional electronic spectroscopy to map energy transfer pathways

  • In situ approaches:

    • Cryo-electron tomography of thylakoid membranes with integrated apocytochrome f

    • Super-resolution microscopy to visualize distribution and dynamics in reconstituted systems

  • Hybrid methods:

    • Combining experimental data with molecular dynamics simulations

    • Integrative structural biology approaches using small-angle X-ray scattering and NMR

These techniques provide unprecedented resolution for understanding electron transfer mechanisms .

How can researchers use Recombinant Lepidium virginicum Apocytochrome f to investigate stress responses in photosynthetic systems?

Methodological approaches for stress response studies include:

  • In vitro oxidative stress experiments:

    • Expose purified protein to controlled levels of reactive oxygen species

    • Assess structural changes and functional impairment using spectroscopic methods

    • Measure changes in redox potential under stress conditions

  • Reconstituted systems under stress:

    • Incorporate protein into liposomes or nanodiscs

    • Apply temperature, pH, or salt stress

    • Monitor electron transfer efficiency changes

  • Comparative studies with stress-tolerant species:

    • Compare responses with apocytochrome f from extremophile plants

    • Identify structural features conferring stress resistance

  • Site-directed mutagenesis:

    • Engineer mutations mimicking oxidative damage

    • Assess impact on protein stability and function

These approaches help understand how environmental stressors affect photosynthetic efficiency at the molecular level .

What are the challenges and solutions for studying membrane integration of Recombinant Lepidium virginicum Apocytochrome f?

Membrane protein research faces specific challenges:

  • Expression challenges:

    • Problem: Poor expression of full-length protein including transmembrane domain

    • Solution: Use specialized membrane protein expression systems like C43(DE3) E. coli strain

  • Solubilization and purification:

    • Problem: Maintaining native structure during extraction from membranes

    • Solution: Screen detergents systematically (DDM, LMNG, CHAPS) for optimal extraction

  • Functional reconstitution:

    • Problem: Achieving proper orientation in artificial membranes

    • Solution: Directional reconstitution using pH gradients during proteoliposome formation

  • Structural analysis:

    • Problem: Obtaining structural data in membrane environment

    • Solution: Use nanodiscs or amphipols to stabilize membrane domains for cryo-EM studies

These methodological refinements significantly improve research outcomes for membrane-associated studies .

How can researchers investigate potential novel functions of Lepidium virginicum Apocytochrome f beyond photosynthetic electron transport?

Exploration of non-canonical functions requires specific approaches:

  • Signaling interactions:

    • Perform pull-down assays with thylakoid extracts to identify novel binding partners

    • Use proximity labeling techniques (BioID, APEX) to map the protein interaction network

  • Stress response roles:

    • Compare protein modifications under various stress conditions

    • Investigate potential moonlighting functions during extreme environmental conditions

  • Cross-talk with cellular pathways:

    • Examine potential interactions with retrograde signaling components

    • Investigate connections to redox regulation pathways

  • Evolutionary analysis:

    • Conduct phylogenetic analysis to identify conserved domains unrelated to electron transport

    • Compare sequences across plant lineages to identify domains under different selection pressures

This research may reveal unexpected functions and evolutionary adaptations of this ancient protein .

What insights can be gained by studying the interaction between Lepidium virginicum Apocytochrome f and water-soluble chlorophyll-binding proteins (WSCPs)?

This novel research direction offers unique perspectives:

  • Interaction analysis:

    • Co-immunoprecipitation studies to detect physical interactions

    • FRET experiments to measure proximity in reconstituted systems

  • Functional coupling:

    • Measure electron transfer between apocytochrome f and chlorophylls bound to WSCPs

    • Investigate potential energy transfer pathways using ultrafast spectroscopy

  • Structural studies:

    • Co-crystallization attempts to capture transient complexes

    • Molecular docking simulations to predict interaction interfaces

  • Physiological relevance:

    • Investigate co-expression patterns under various growth conditions

    • Examine co-localization in thylakoid membrane subdomains

Recent research on Lepidium virginicum WSCPs has revealed important insights into chlorophyll binding and energy transfer, suggesting potential functional connections to the electron transport chain that merit further investigation .

What are the common challenges in obtaining active Recombinant Lepidium virginicum Apocytochrome f and how can they be addressed?

Researchers frequently encounter specific challenges that can be methodically addressed:

  • Low expression yields:

    • Problem: Poor protein accumulation in E. coli

    • Solution: Optimize codon usage for E. coli, lower induction temperature to 16°C, use Terrific Broth media

  • Inclusion body formation:

    • Problem: Protein aggregation during expression

    • Solution: Co-express with molecular chaperones (GroEL/GroES), use fusion partners (SUMO, MBP)

  • Improper heme incorporation:

    • Problem: Production of apo-protein lacking heme

    • Solution: Supplement growth media with δ-aminolevulinic acid and iron, ensure aerobic growth conditions

  • Proteolytic degradation:

    • Problem: Protein instability during purification

    • Solution: Include protease inhibitor cocktail, maintain low temperature (4°C) throughout purification

These interventions significantly improve yield and quality of the recombinant protein .

How can researchers differentiate between native and denatured conformations of Recombinant Lepidium virginicum Apocytochrome f?

Multiple analytical techniques provide complementary information:

  • Spectroscopic methods:

    • UV-visible spectroscopy: Native protein shows characteristic Soret band (~420 nm)

    • Circular dichroism: Compare secondary structure profile with predicted patterns

    • Fluorescence spectroscopy: Monitor changes in intrinsic tryptophan fluorescence

  • Functional assays:

    • Redox activity: Measure electron transfer capability with artificial donors/acceptors

    • Binding assays: Test interaction with known partners like plastocyanin

  • Structural assessment:

    • Size exclusion chromatography: Monitor elution profile for aggregation

    • Thermal shift assays: Compare melting temperatures of protein preparations

    • Limited proteolysis: Properly folded proteins show distinctive digestion patterns

These approaches provide a comprehensive assessment of protein structural integrity .

What considerations are important when designing experiments to study Recombinant Lepidium virginicum Apocytochrome f interactions with other photosynthetic proteins?

Experimental design should address these methodological considerations:

  • Buffer composition:

    • Use buffers mimicking thylakoid lumen environment (pH 5.5-6.5)

    • Include physiologically relevant ions (Mg²⁺, Ca²⁺)

    • Control ionic strength carefully as it modulates electrostatic interactions

  • Redox state control:

    • Maintain defined redox potential using chemical reductants/oxidants

    • Consider oxygen exclusion for reduced state studies

    • Monitor redox state spectroscopically throughout experiments

  • Binding kinetics:

    • Account for transient interactions typical of electron transport components

    • Use stopped-flow techniques for fast association/dissociation rates

    • Consider temperature effects on binding equilibria

  • Competitive interactions:

    • Include physiological competitors when relevant

    • Consider concentration ranges typical of in vivo conditions

    • Account for membrane effects on effective concentrations

Attention to these factors ensures physiologically relevant results and improves reproducibility .

How can Recombinant Lepidium virginicum Apocytochrome f contribute to understanding plant adaptation to environmental stress?

This research area offers significant potential for agricultural applications:

  • Comparative studies across ecotypes:

    • Express and characterize apocytochrome f from Lepidium virginicum ecotypes from diverse habitats

    • Compare structural stability and electron transfer efficiency under stress conditions

    • Identify sequence variations correlating with stress tolerance

  • Engineering stress-tolerant variants:

    • Introduce mutations based on naturally stress-resistant homologs

    • Test functional properties under temperature, salt, and oxidative stress

    • Evaluate potential for improving photosynthetic efficiency under suboptimal conditions

  • Systems biology integration:

    • Correlate apocytochrome f modifications with transcriptomic and metabolomic changes

    • Model electron transport chain performance under various stress scenarios

    • Identify rate-limiting steps that could be targeted for improvement

This research connects fundamental protein science to applied agricultural biotechnology .

What potential applications exist for using structural knowledge of Lepidium virginicum Apocytochrome f in designing artificial photosynthetic systems?

Bioinspired design presents exciting research opportunities:

  • Biomimetic electron transport chains:

    • Design simplified protein modules based on key functional domains

    • Engineer protein-nanoparticle hybrids incorporating redox-active centers

    • Optimize electron transfer pathways for industrial applications

  • Bio-hybrid energy conversion:

    • Integrate modified apocytochrome f with electrodes for bioelectrochemical systems

    • Couple protein function to artificial reaction centers for light harvesting

    • Develop self-assembling protein arrays for efficient electron collection

  • Methodological approaches:

    • Use protein engineering to simplify complex natural systems

    • Employ directed evolution to enhance desired properties

    • Apply computational design to optimize protein-surface interactions

These applications extend the fundamental knowledge of natural photosynthesis to synthetic systems with potential technological applications .

How does research on Lepidium virginicum Apocytochrome f connect to broader studies on plant biochemistry and potential medicinal applications?

Interdisciplinary connections reveal unexpected research opportunities:

  • Connection to plant secondary metabolism:

    • Investigate relationships between electron transport efficiency and biosynthetic pathways

    • Explore how photosynthetic performance influences production of bioactive compounds

    • Study regulatory connections between redox state and defense compound production

  • Potential biomedical relevance:

    • Recent research shows Lepidium virginicum extracts possess cytotoxic activity against colorectal cancer

    • Investigate whether components of the photosynthetic apparatus contribute to observed bioactivities

    • Explore structural similarities between plant electron transport proteins and therapeutic targets

  • Methodological crossover:

    • Apply techniques developed for photosynthesis research to study plant-derived bioactive compounds

    • Use systems biology approaches to connect photosynthetic efficiency with medicinal properties

    • Develop screening methods to identify novel bioactive components

These connections highlight how fundamental research on photosynthetic proteins can inform diverse scientific disciplines and potentially lead to therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.