Recombinant Lepidium virginicum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format we currently have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
It is recommended to avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Lepidium virginicum (Virginia pepperweed)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSQTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH
Uniprot No.

Target Background

Function
This protein plays a crucial role as a key component of the proton channel, directly involved in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the challenges in expressing recombinant Lepidium virginicum atpI?

Expression of membrane proteins like atpI presents several challenges:

  • Expression system selection: E. coli is the most commonly used system for atpI expression, but optimization is essential. The protein has been successfully expressed in E. coli with an N-terminal His-tag .

  • Toxicity management: Membrane protein overexpression can be toxic to host cells. Using specialized strains like C43(DE3) that are designed for membrane protein expression can improve yields.

  • Induction conditions: Lower temperatures (16-20°C) after induction often improve folding and reduce inclusion body formation.

  • Codon optimization: Adapting the coding sequence to E. coli codon usage can significantly enhance expression levels.

  • Solubilization strategy: Proper detergent selection is critical. A systematic screening approach starting with mild detergents like DDM or LMNG is recommended.

To validate proper expression, Western blotting using anti-His antibodies can confirm the presence of the full-length protein, while subsequent purification steps can assess protein quality.

How should researchers store and reconstitute recombinant Lepidium virginicum atpI?

For optimal stability and activity retention, follow these guidelines:

Storage recommendations:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For optimal stability, add glycerol to a final concentration of 5-50%

  • The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For functional studies, researchers should consider reconstitution into liposomes with lipid compositions mimicking the chloroplast membrane, which requires additional optimization of lipid-to-protein ratios and reconstitution procedures.

What is the purification strategy for recombinant His-tagged Lepidium virginicum atpI?

A systematic purification approach for His-tagged atpI includes:

  • Cell lysis and membrane preparation:

    • Lyse cells using sonication or high-pressure homogenization

    • Isolate membranes through differential centrifugation

    • Solubilize membrane proteins using an optimized detergent

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Bind solubilized protein to Ni-NTA resin

    • Wash with increasing imidazole concentrations (typically 20-50 mM)

    • Elute with high imidazole (250-500 mM)

  • Size Exclusion Chromatography (SEC):

    • Further purify using gel filtration to remove aggregates

    • Analyze oligomeric state and homogeneity

    • Collect fractions containing monomeric protein

Throughout purification, maintain detergent concentrations above CMC and include protease inhibitors. Purity greater than 90% can be achieved as determined by SDS-PAGE .

How can researchers assess the functional activity of recombinant atpI?

Evaluating the functional activity of recombinant atpI requires specialized approaches:

  • Reconstitution into proteoliposomes:

    • Prepare liposomes with defined lipid composition

    • Incorporate purified atpI using detergent-mediated reconstitution

    • Remove detergent via dialysis or Bio-Beads

    • Verify incorporation using freeze-fracture electron microscopy

  • Proton translocation assays:

    • Create a pH gradient across the proteoliposome membrane

    • Monitor pH changes using fluorescent dyes (ACMA, pyranine)

    • Measure fluorescence changes upon addition of ionophores

    • Calculate proton flux rates under different conditions

  • ATP synthesis assays:

    • Co-reconstitute atpI with other ATP synthase subunits

    • Establish a proton gradient using ionophores

    • Measure ATP synthesis using luciferase-based assays

  • Binding studies:

    • Assess interactions with other ATP synthase components

    • Use techniques like surface plasmon resonance or co-immunoprecipitation

    • Quantify binding kinetics and affinity

These approaches provide complementary information about different aspects of atpI function within the ATP synthase complex.

What controls are essential when characterizing recombinant atpI?

Rigorous controls are critical for reliable characterization:

  • Expression and purification controls:

    • Empty vector expression processed identically to atpI expression

    • SDS-PAGE and Western blotting to verify size and immunoreactivity

    • Mass spectrometry to confirm protein identity

  • Functional assay controls:

    • Heat-inactivated protein to distinguish enzymatic from non-enzymatic effects

    • Empty liposomes processed identically to protein-containing liposomes

    • Verification of protein orientation in reconstituted systems

  • Specificity controls:

    • Site-directed mutants of key functional residues

    • Competition assays with known interaction partners

    • Comparison with related but distinct proteins

  • Validation approaches:

    • Multiple independent protein preparations (biological replicates)

    • Different detection methods for key parameters

    • Appropriate statistical analysis of replicate data

These controls help distinguish genuine functional characteristics from artifacts and ensure reproducibility of findings.

How can researchers optimize reconstitution of atpI for functional studies?

Successful reconstitution requires optimization of several parameters:

  • Lipid composition:

    • Test mixtures mimicking chloroplast membranes (including MGDG, DGDG, SQDG)

    • Optimize cholesterol content for membrane fluidity

    • Consider including specific lipids known to interact with ATP synthase

  • Protein-to-lipid ratio:

    • Test ratios from 1:50 to 1:500 (w/w)

    • Balance between protein incorporation efficiency and liposome stability

    • Optimize for specific functional assays

  • Reconstitution method:

    • Compare detergent removal techniques (dialysis, Bio-Beads, gel filtration)

    • Optimize rate of detergent removal

    • Control liposome size through extrusion

  • Buffer conditions:

    • Test pH range (typically 6.5-8.0)

    • Optimize ionic strength

    • Include stabilizing agents (glycerol, trehalose)

  • Verification methods:

    • Freeze-fracture electron microscopy to visualize protein incorporation

    • Density gradient centrifugation to separate empty liposomes

    • Fluorescence-based assays to verify protein orientation

Systematic optimization of these parameters is essential for obtaining functionally active reconstituted atpI.

What techniques can be used to study atpI oligomerization and interactions?

Multiple complementary approaches can assess atpI oligomerization and interactions:

  • Size exclusion chromatography (SEC):

    • Analyze apparent molecular weight in detergent micelles

    • Compare with theoretical mass of monomer

    • Detect potential oligomeric species

  • Chemical crosslinking:

    • Use membrane-permeable crosslinkers of different lengths

    • Analyze crosslinked products by SDS-PAGE and mass spectrometry

    • Identify specific interaction interfaces

  • Förster Resonance Energy Transfer (FRET):

    • Label protein with donor/acceptor fluorophores

    • Measure energy transfer as indicator of proximity

    • Calculate distances between labeled residues

  • Native mass spectrometry:

    • Analyze intact membrane protein complexes

    • Determine stoichiometry of interactions

    • Identify non-covalent binding partners

  • Cryo-electron microscopy:

    • Visualize protein complexes at near-atomic resolution

    • Determine structural arrangement of oligomers

    • Map interaction interfaces

These techniques provide complementary information about atpI interactions within the ATP synthase complex and potential homo-oligomerization.

How might atpI contribute to Lepidium virginicum's antiparasitic properties?

Evidence suggests that Lepidium virginicum exhibits antiparasitic activity against protozoan parasites, particularly Entamoeba histolytica, with a pooled mean IC50 of 198.6 μg/mL based on meta-analysis results . While the specific contribution of atpI remains to be fully elucidated, several potential mechanisms can be investigated:

  • Disruption of parasite bioenergetics:

    • ATP synthase is essential for energy metabolism in parasites

    • If atpI or peptides derived from it interfere with parasite ATP synthase function, this could compromise energy production

    • Methodology: Compare activity of purified atpI against isolated parasite ATP synthase

  • Membrane disruption:

    • As a membrane protein, atpI or its derivatives might interact with parasite membranes

    • This interaction could affect membrane integrity or function

    • Methodology: Assess effects of atpI-derived peptides on model membranes and parasite cell membranes

  • Immunomodulatory effects:

    • Plant proteins can sometimes stimulate host immune responses

    • Enhanced immune activation could contribute to parasite clearance

    • Methodology: Evaluate cytokine production in immune cells exposed to atpI

Experimental approaches to investigate these mechanisms include fractionation of plant extracts, recombinant expression of atpI, and direct testing against parasite cultures.

What role might atpI play in ion transport across chloroplast membranes?

Beyond its structural role in ATP synthase, evidence suggests atpI may function in ion transport:

AtpI has been hypothesized to function as a Mg2+ transporter, Ca2+ transporter, or channel protein, potentially as homooligomers or heterooligomers . This expanded functional role has significant physiological implications:

  • Magnesium homeostasis:

    • Mg2+ is essential for chlorophyll function and photosynthetic efficiency

    • AtpI-mediated Mg2+ transport could help maintain optimal concentrations in the chloroplast

    • Methodology: Measure Mg2+ flux in proteoliposomes containing reconstituted atpI

  • Calcium signaling:

    • Ca2+ serves as a secondary messenger in various cellular processes

    • AtpI-mediated Ca2+ transport might contribute to signaling pathways

    • Methodology: Use Ca2+-sensitive fluorescent dyes to monitor ion movement

  • Experimental approaches:

    • Electrophysiological studies to measure ion conductance and selectivity

    • Isotope flux assays using radiolabeled ions

    • Yeast complementation studies in strains lacking specific ion transporters

These investigations would provide valuable insights into the multifunctional nature of atpI beyond its role in ATP synthesis.

How does the ancestral reconstruction approach inform our understanding of atpI evolution?

Ancestral sequence reconstruction provides valuable insights into the evolution of ATP synthase components:

In research with yeast V-ATPase, ancestral gene reconstruction was used to generate the most recent common ancestor of two subunit a isoforms (Vph1p and Stv1p), called Anc.a . This ancestral protein showed dual localization to both the Golgi/endosomal network and vacuolar membrane, suggesting that the specialized targeting of modern isoforms evolved from a less specific ancestral state .

Similar approaches applied to plant atpI could reveal:

  • Evolutionary trajectory:

    • Reconstruct ancestral sequences at key points in plant evolution

    • Express and characterize these ancestral proteins

    • Compare functional properties with modern atpI

  • Specialization mechanisms:

    • Identify mutations that led to specialized functions

    • Determine when key functional innovations emerged

    • Map the acquisition of plant-specific features

  • Methodological approach:

    • Collect diverse atpI sequences across plant lineages

    • Use maximum likelihood methods to infer ancestral sequences

    • Express reconstructed proteins and assess localization and function

This evolutionary perspective can provide context for understanding structural adaptations and functional diversification in modern ATP synthase complexes.

What structural modifications of atpI might enhance its research applications?

Strategic modifications can significantly improve atpI's utility for various research applications:

  • Affinity tags:

    • His6/10-tags for efficient purification

    • Strep-tag II or FLAG-tag for alternative purification strategies

    • Twin-Strep-tag for higher affinity purification

  • Fluorescent protein fusions:

    • GFP or mCherry for localization studies

    • Split fluorescent protein systems for interaction studies

    • Optimized linker sequences to minimize functional interference

  • Site-directed modifications:

    • Cysteine-less variants to eliminate non-specific labeling

    • Engineered cysteines for site-specific fluorophore attachment

    • TEV protease sites for tag removal after purification

  • Stability engineering:

    • Thermostabilizing mutations based on consensus sequences

    • Disulfide bonds to stabilize tertiary structure

    • Surface entropy reduction to improve crystallization properties

Each modification should be carefully designed based on structural information or homology models and empirically tested for its impact on protein expression, stability, and function.

How should researchers interpret contradictory results when studying atpI function?

When faced with contradictory data regarding atpI function, implement a systematic approach:

  • Identify sources of variability:

    • Expression systems (E. coli strains, growth conditions)

    • Purification methods (detergents, buffer compositions)

    • Protein quality (aggregation state, post-translational modifications)

    • Assay conditions (lipid composition, pH, temperature)

  • Resolution strategies:

    • Directly compare experimental conditions between studies

    • Perform controlled experiments varying only one parameter at a time

    • Employ orthogonal techniques to verify findings

    • Consider if results reflect different aspects of a complex function

  • Validation approaches:

    • Reproduce key experiments in different laboratories

    • Use multiple independent protein preparations

    • Apply statistical methods appropriate for the experimental design

When publishing, acknowledge contradictions in literature, explain methodological differences that might account for discrepancies, and consider alternative interpretations of the data.

What are common pitfalls in atpI protein purification and how can they be addressed?

Recognizing and addressing common purification challenges is essential:

  • Protein misfolding:

    • Symptom: Low yield, aggregation, lack of activity

    • Solution: Optimize expression conditions (temperature, inducer concentration)

    • Validation: Assess folding through circular dichroism or limited proteolysis

  • Detergent-induced artifacts:

    • Symptom: Variable activity depending on detergent

    • Solution: Screen multiple detergents; consider nanodiscs or SMALPs

    • Validation: Compare activity in different membrane environments

  • Incomplete solubilization:

    • Symptom: Protein remains in insoluble fraction

    • Solution: Optimize detergent type, concentration, and solubilization time

    • Validation: Quantify protein in soluble vs. insoluble fractions

  • Non-specific binding to chromatography media:

    • Symptom: Poor separation, co-purification of contaminants

    • Solution: Optimize imidazole concentration in washing steps

    • Validation: Analyze elution fractions by SDS-PAGE

  • Protein instability:

    • Symptom: Activity loss during purification

    • Solution: Include stabilizing additives (glycerol, specific lipids)

    • Validation: Measure activity at different purification stages

These challenges can be addressed through systematic optimization and implementation of appropriate quality control measures throughout the purification process.

How can researchers distinguish specific atpI functions from artifacts in reconstituted systems?

Discriminating genuine functions from artifacts requires rigorous controls:

  • Empty liposome controls:

    • Prepare liposomes without protein using identical procedures

    • Test for all activities being measured

    • Quantify background signal or activity

  • Protein orientation verification:

    • Use antibodies against epitopes on known sides of the membrane

    • Employ protease protection assays to confirm topology

    • Quantify the fraction of correctly oriented protein

  • Activity specificity controls:

    • Site-directed mutants of key functional residues

    • Heat-inactivated protein

    • Specific inhibitors when available

  • Signal validation:

    • Use multiple detection methods for key parameters

    • Include positive controls with known activity

    • Perform concentration-dependent measurements

  • Membrane integrity assessment:

    • Monitor liposome leakage using entrapped fluorescent dyes

    • Measure membrane potential using voltage-sensitive probes

    • Verify size distribution and morphology by electron microscopy

By implementing these controls systematically, researchers can confidently distinguish genuine atpI functions from experimental artifacts in reconstituted systems.

How can researchers optimize conditions for functional studies of atpI?

Systematic optimization is key to successful functional characterization:

  • Buffer optimization:

    • pH range screening (typically 6.0-8.5)

    • Ionic strength variation (50-300 mM)

    • Buffer type comparison (HEPES, Tris, phosphate)

  • Lipid environment:

    • Test different lipid compositions mimicking chloroplast membranes

    • Optimize cholesterol or ergosterol content

    • Compare liposomes, nanodiscs, and native membrane fragments

  • Temperature effects:

    • Determine temperature optimum for activity

    • Assess temperature stability

    • Consider temperature-dependent conformational changes

  • Optimization strategy:

    • Initial broad screening followed by fine-tuning

    • Design of experiments (DoE) approach for multifactorial optimization

    • Response surface methodology to identify optimal conditions

  • Validation across assays:

    • Confirm that optimized conditions work across different functional assays

    • Verify that conditions don't compromise protein stability

    • Compare with conditions used for homologous proteins

This systematic approach will identify conditions that support maximal functional activity while maintaining protein stability and physiological relevance.

How does Lepidium virginicum atpI compare to atpI proteins from other plant species?

Comparative analysis reveals important structural and functional insights:

The 249-amino acid length of Lepidium virginicum atpI is consistent with other plant atpI proteins . Sequence alignment across species shows:

  • Highly conserved regions:

    • Transmembrane domains involved in proton translocation

    • Residues at subunit interfaces within the ATP synthase complex

    • Catalytically important amino acids

  • Variable regions:

    • N-terminal transit peptide sequences

    • Some loop regions connecting transmembrane segments

    • Surface-exposed residues not critical for function

  • Phylogenetic relationships:

    • Lepidium virginicum atpI clusters with other Brassicaceae family members

    • Sequence divergence correlates with evolutionary distance

    • Conserved motifs can be used for phylogenetic studies

These comparisons provide context for understanding how atpI structure and function have been maintained through evolution while allowing for species-specific adaptations.

What can be learned from comparing chloroplast atpI with bacterial homologs?

Comparing plant chloroplastic atpI with bacterial homologs provides evolutionary and functional insights:

  • Structural adaptations:

    • Plant atpI has evolved specific modifications compared to bacterial homologs

    • These may include extensions or modified loops

    • Interface regions show adaptations specific to chloroplast ATP synthases

  • Functional specialization:

    • Chloroplast atpI operates in the acidic environment created by photosynthesis

    • Regulatory mechanisms are coordinated with photosynthetic processes

    • Potential differences in ion specificity or conductance properties

  • Research implications:

    • Expression and purification strategies need to be optimized for plant proteins

    • Different lipid environments may be needed for reconstitution

    • Antibodies against bacterial proteins may show limited cross-reactivity

Understanding these differences is crucial for researchers working with plant atpI, as methodologies developed for bacterial systems often require significant adaptation.

How does atpI function compare between different subcellular locations?

ATP synthase subunit a proteins function in different organelles, with specialized adaptations:

  • Chloroplast vs. mitochondrial ATP synthase subunit a:

    • Chloroplast atpI is optimized for thylakoid membranes

    • Mitochondrial ATP6 has adapted to the inner mitochondrial membrane

    • Different lipid environments have driven specific adaptations

  • Functional specialization:

    • Chloroplast atpI couples with light-driven proton pumping

    • Mitochondrial ATP6 coordinates with respiratory chain complexes

    • Regulatory mechanisms reflect different energy sources

  • Targeting mechanisms:

    • Distinct targeting signals direct proteins to appropriate organelles

    • These signals can be identified through comparative sequence analysis

    • Ancestral reconstruction approaches can reveal evolutionary trajectories

These comparisons provide a framework for understanding how similar proteins have adapted to different subcellular environments and offer insights for engineering ATP synthase components with desired properties.

What is the role of atpI in inter-protein interactions within the ATP synthase complex?

AtpI mediates critical interactions within the ATP synthase complex:

  • Structural role:

    • Forms part of the stator that prevents rotation of the entire complex

    • Provides the proton channel in conjunction with the c-ring

    • Contributes to the stability of the F0 sector

  • Key interactions:

    • Direct contact with the c-ring subunits in the membrane

    • Association with other stator components

    • Potential interactions with lipids that affect complex stability

  • Investigating interactions:

    • Crosslinking studies can identify residues at interaction interfaces

    • Mutagenesis of key residues can disrupt specific interactions

    • Computational modeling based on related structures

  • Functional consequences:

    • Proper interactions are essential for proton translocation

    • Disrupted interactions can uncouple proton flow from ATP synthesis

    • Some interactions may be involved in regulatory mechanisms

Understanding these interactions is crucial for elucidating the complete structure-function relationship of ATP synthase and may reveal potential targets for modulating its activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.