Recombinant Lepidium virginicum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant NDH-4L is produced via heterologous expression in E. coli, with a His-tag for affinity purification.

Applications

  1. ELISA Development: Used as an antigen in enzyme-linked immunosorbent assays to detect NDH-4L antibodies or study protein-protein interactions .

  2. Structural Analysis: Serves as a model for studying subunit assembly in the NDH complex, particularly its interaction with other subunits like F, H, I, and K .

  3. Functional Studies: Investigates proton translocation mechanisms and electron transfer efficiency in chloroplasts .

Comparative Analysis with Related Subunits

While NDH-4L is specific to Lepidium virginicum, structural data from homologs in Hordeum vulgare (barley) provide insights into conserved features .

SubunitOrganismMolecular Weight (kDa)Role in NDH Complex
4LLepidium virginicum~11.2Proton translocation
FHordeum vulgare~87.6Core subunit, redox activity
HHordeum vulgare~44.6Membrane-anchoring
IHordeum vulgare~19.3Subunit assembly

Key Research Findings

  1. Subunit Interactions: NDH-4L interacts with subunits F, H, and K to form a functional core .

  2. Proton Translocation: The NDH complex uses subunits like 4L to translocate protons across the thylakoid membrane, contributing to ATP synthesis .

  3. Oxidoreductase Activity: The complex catalyzes NAD(P)H-to-plastoquinone electron transfer, critical for balancing linear and cyclic electron flows .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your required tag type at the time of ordering for preferential development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Lepidium virginicum (Virginia pepperweed)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGD IFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK
Uniprot No.

Target Background

Function

NDH (NAD(P)H dehydrogenase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic electron transport chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the primary function of NAD(P)H-quinone oxidoreductase subunit 4L in Lepidium virginicum chloroplasts?

The NAD(P)H-quinone oxidoreductase subunit 4L in L. virginicum chloroplasts likely functions as a component of the chloroplast electron transport chain, specifically within the NADH dehydrogenase-like (NDH) complex. This protein participates in cyclic electron flow around photosystem I, contributing to ATP synthesis without net NADPH production. This process is particularly important under stress conditions when linear electron transport may be compromised. While the specific role in L. virginicum has not been fully characterized, research on homologous proteins suggests it plays a crucial role in maintaining redox balance during photosynthesis .

How does the Lepidium virginicum variant of this protein differ from those found in other Brassicaceae species?

Sequence analysis suggests that the L. virginicum variant shares significant homology with other Brassicaceae NAD(P)H-quinone oxidoreductases but contains unique amino acid substitutions that may influence substrate specificity and catalytic efficiency. These differences may relate to the adaptation of L. virginicum to specific environmental conditions. Comparative studies with other Brassicaceae species indicate that L. virginicum proteins often display distinctive structural features that correlate with their medicinal properties and stress tolerance capabilities .

What expression patterns are observed for this protein during plant development?

Similar to other chloroplastic proteins in Brassicaceae, expression of NAD(P)H-quinone oxidoreductase subunit 4L follows distinct patterns during seedling etiolation and de-etiolation. Studies on related proteins demonstrate upregulation during light-induced chloroplast development. Expression is typically highest in photosynthetically active tissues and increases during the transition from etioplasts to functional chloroplasts. The protein shows light-dependent expression patterns, with significant accumulation occurring within 2-4 hours after dark-grown seedlings are exposed to light .

What are the optimal conditions for expressing recombinant L. virginicum NAD(P)H-quinone oxidoreductase subunit 4L in bacterial systems?

For optimal heterologous expression in E. coli systems, the following protocol is recommended:

  • Clone the mature protein-coding sequence (without transit peptide) into pET-28a(+) vector with an N-terminal His-tag

  • Transform into BL21(DE3) strain

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.5 mM IPTG

  • Shift temperature to 18°C and continue expression for 16-18 hours

  • Harvest cells and lyse in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 1 mM DTT

This approach minimizes inclusion body formation and maintains protein solubility. The addition of 0.5% Triton X-100 during purification helps preserve enzymatic activity by maintaining proper protein folding .

How can researchers effectively isolate chloroplasts from L. virginicum to study native NAD(P)H-quinone oxidoreductase?

For effective chloroplast isolation from L. virginicum tissues:

  • Section seedlings into consecutive 1 cm segments

  • Homogenize in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.6, 1 mM MgCl2, 1 mM EDTA, 0.1% BSA)

  • Filter through two layers of Miracloth

  • Perform differential centrifugation (300×g for 1 min, then 1000×g for 5 min)

  • Resuspend pellet and layer onto a Percoll density gradient

  • Centrifuge at 3500×g for 15 minutes

  • Collect intact chloroplasts at the interface

This methodology yields high-quality chloroplasts suitable for subsequent protein purification and functional assays. The addition of protease inhibitors throughout the procedure is essential to prevent protein degradation .

What analytical methods are most effective for assessing the enzymatic activity of this protein?

The enzymatic activity of NAD(P)H-quinone oxidoreductase can be effectively measured using:

  • Spectrophotometric assays:

    • Monitor NADH/NADPH oxidation at 340 nm

    • Use 2,6-dichlorophenolindophenol (DCPIP) as electron acceptor

    • Include FMN (10 μM) as cofactor

  • Oxygen consumption assays:

    • Clark-type electrode measurements

    • Reaction mixture containing 50 mM potassium phosphate buffer (pH 7.5), 200 μM NADH/NADPH, and 100 μM quinone substrate

  • Fluorescence-based detection:

    • Measure changes in NAD(P)H fluorescence (excitation 340 nm, emission 460 nm)

    • Correlate with enzyme activity

The choice of quinone substrate significantly impacts measured activity, with decylubiquinone typically yielding optimal results for chloroplastic isoforms .

How does the protein structure contribute to its electron transport function?

The NAD(P)H-quinone oxidoreductase subunit 4L likely contains:

  • An N-terminal NAD(P)H binding domain with the characteristic Rossmann fold

  • A central domain containing conserved acidic residues that participate in proton translocation

  • A C-terminal quinone-binding region with hydrophobic pocket

The protein's electron transport capability depends on precise positioning of redox-active residues that facilitate sequential electron transfer from NAD(P)H to quinone substrates. Molecular modeling suggests that L. virginicum variants possess unique structural features that may enhance catalytic efficiency under specific environmental conditions .

What protein-protein interactions are critical for the functioning of this protein within chloroplast complexes?

This protein likely participates in multiple protein-protein interactions within the chloroplast NDH complex:

  • Association with other NDH subunits to form a functional electron transport complex

  • Interaction with ferredoxin-binding proteins that facilitate electron transfer

  • Potential transient interactions with components of photosystem I during cyclic electron flow

Co-immunoprecipitation studies with related proteins indicate that these interactions are often regulated by light conditions and redox state of the chloroplast. The stability of these complexes can be significantly affected by environmental stress factors, particularly high light intensity and temperature fluctuations .

What post-translational modifications regulate the activity of this enzyme?

Key post-translational modifications likely include:

Modification TypePositionFunctional Impact
PhosphorylationSer/Thr residuesRegulates enzyme activity and protein-protein interactions
Thiol modificationCysteine residuesResponds to redox state changes in chloroplast
N-terminal processingTransit peptideRequired for chloroplast import and maturation

These modifications play crucial roles in regulating protein activity in response to changing environmental conditions and metabolic demands. In particular, phosphorylation events appear to modulate the protein's interaction with other components of the electron transport chain, thereby fine-tuning its contribution to photosynthetic efficiency .

How can this protein be used to study stress responses in plants?

The NAD(P)H-quinone oxidoreductase subunit 4L serves as an excellent model for studying plant stress responses because:

  • Its expression and activity levels change predictably under various stress conditions

  • It participates in cyclic electron flow, which is enhanced during stress

  • Its regulatory mechanisms reflect cellular adaptations to environmental challenges

Experimental approaches include:

  • Generating transgenic lines with modified expression levels

  • Assessing changes in photosynthetic efficiency under stress conditions

  • Correlating protein activity with ROS production and antioxidant responses

  • Measuring cyclic electron flow rates as indicators of stress adaptation

These studies can provide valuable insights into how plants balance energy production and photoprotection during exposure to adverse environmental conditions .

What is the relationship between this protein and the anticancer properties observed in L. virginicum extracts?

While the direct relationship remains to be fully characterized, evidence suggests potential connections:

  • NAD(P)H-quinone oxidoreductases can catalyze the reduction of quinones found in plant extracts, potentially activating compounds with anticancer properties

  • Quinone reduction may generate reactive oxygen species that contribute to cytotoxicity in cancer cells

  • The protein may participate in biosynthetic pathways producing secondary metabolites with anticancer activity

Studies have demonstrated that L. virginicum methanolic extracts induce apoptosis in colorectal cancer cell lines (Caco-2) through p53-dependent mechanisms and caspase-3 activation. Extract treatment resulted in a 5.4-fold increase in caspase-3 expression and a 2.2-fold increase in p53 mRNA compared to controls. These effects may involve bioactive compounds whose production or activation is influenced by NAD(P)H-quinone oxidoreductase activity .

How do mutations in this protein impact photosynthetic efficiency?

Mutations in NAD(P)H-quinone oxidoreductase subunit 4L can significantly impact photosynthetic performance:

  • Alterations in catalytic residues may reduce electron transport rates, limiting cyclic electron flow

  • Mutations affecting protein-protein interactions can disrupt NDH complex assembly

  • Changes in regulatory domains may alter the protein's response to environmental cues

Experimental evidence indicates that plants with impaired function of this protein show:

  • Reduced photosynthetic efficiency under fluctuating light conditions

  • Increased susceptibility to photoinhibition

  • Altered non-photochemical quenching capacity

  • Compromised growth under environmental stress conditions

These phenotypes highlight the protein's importance in maintaining photosynthetic homeostasis, particularly under challenging environmental conditions .

What are the major challenges in purifying active recombinant L. virginicum NAD(P)H-quinone oxidoreductase?

Researchers face several significant challenges:

  • Maintaining solubility during expression and purification

  • Preserving native cofactor associations

  • Preventing oxidative damage during processing

  • Achieving proper folding in heterologous systems

Effective solutions include:

  • Using specialized expression vectors with solubility-enhancing tags

  • Including appropriate cofactors (FMN, FAD) in purification buffers

  • Maintaining reducing conditions throughout purification

  • Employing mild detergents to mimic membrane environment

  • Utilizing chaperone co-expression systems to improve folding

Adding 10% glycerol and 0.1% Triton X-100 to purification buffers has been shown to significantly enhance protein stability and preserve enzymatic activity .

How can researchers effectively measure the in vivo activity of this protein in plant tissues?

In vivo activity assessment presents unique challenges requiring specialized approaches:

  • Non-invasive spectroscopic techniques:

    • Chlorophyll fluorescence analysis (particularly P700+ re-reduction kinetics)

    • Monitoring post-illumination chlorophyll fluorescence rise as an indicator of NDH activity

  • Isotope labeling approaches:

    • Tracking 13C-labeled carbon flow through photosynthetic pathways

    • Correlating with NAD(P)H-quinone oxidoreductase activity

  • Genetic complementation assays:

    • Using L. virginicum protein to rescue mutant phenotypes in model systems

    • Quantifying restoration of photosynthetic parameters

These methodologies provide complementary insights into the protein's function while maintaining cellular context integrity .

What strategies address the challenges of crystallizing membrane-associated proteins like NAD(P)H-quinone oxidoreductase?

Crystallization of membrane-associated proteins requires specialized approaches:

  • Protein engineering strategies:

    • Creating fusion constructs with crystallization chaperones

    • Removing flexible regions that hinder crystal packing

    • Introducing surface mutations to enhance crystal contacts

  • Solubilization approaches:

    • Testing diverse detergents (DDM, LMNG, GDN)

    • Employing lipid cubic phase crystallization

    • Using amphipols or nanodiscs to maintain native-like environments

  • Crystallization screening:

    • High-throughput robotic screening at varied temperatures

    • Implementing microseeding techniques

    • Utilizing additive screens to improve crystal quality

These approaches have successfully yielded structural information for related proteins, providing templates for molecular modeling of the L. virginicum variant .

How might CRISPR/Cas9 technology be applied to study the role of this protein in L. virginicum?

CRISPR/Cas9 genome editing offers powerful approaches for functional characterization:

  • Precise gene knockout strategies:

    • Target conserved catalytic domains for complete loss-of-function

    • Create tissue-specific knockouts to assess developmental roles

    • Generate conditional mutants for studying essential functions

  • Base editing applications:

    • Introduce specific amino acid substitutions to probe structure-function relationships

    • Modify regulatory elements to alter expression patterns

    • Create variants with altered post-translational modification sites

  • Transcriptional modulation:

    • Use CRISPRi/CRISPRa to fine-tune expression levels

    • Study dose-dependent effects on photosynthetic performance

    • Investigate compensatory mechanisms when expression is altered

These approaches can provide unprecedented insights into the protein's function in vivo while circumventing limitations of traditional genetic approaches in non-model plant species .

What are the potential applications of this protein in synthetic biology and metabolic engineering?

The unique properties of L. virginicum NAD(P)H-quinone oxidoreductase present several opportunities for biotechnological applications:

  • Enhancing photosynthetic efficiency:

    • Engineering improved cyclic electron flow in crop plants

    • Optimizing electron transfer rates for increased carbon fixation

    • Developing variants with enhanced stress tolerance

  • Bioremediation applications:

    • Using the enzyme's quinone-reducing capacity for detoxification of environmental pollutants

    • Engineering plants with enhanced heavy metal tolerance

  • Metabolic engineering platforms:

    • Redirecting electron flow to produce high-value biochemicals

    • Coupling with other redox enzymes for novel biosynthetic pathways

    • Creating synthetic electron transport chains for specialized metabolic processes

These applications leverage the protein's natural electron transfer capabilities while expanding its functional repertoire through protein engineering and synthetic biology approaches .

How might computational approaches advance our understanding of this protein's evolution and function?

Advanced computational methods offer powerful tools for investigating evolutionary and functional aspects:

  • Phylogenetic analysis:

    • Tracing the evolutionary history of NAD(P)H-quinone oxidoreductases across plant lineages

    • Identifying selection pressures and adaptive evolution

    • Correlating sequence divergence with ecological adaptations

  • Molecular dynamics simulations:

    • Modeling protein conformational changes during catalytic cycles

    • Predicting effects of mutations on protein stability and function

    • Investigating protein-protein interaction dynamics

  • Machine learning applications:

    • Predicting regulatory networks controlling protein expression

    • Identifying novel interaction partners

    • Designing improved variants with enhanced catalytic properties

These computational approaches complement experimental studies and can guide hypothesis generation for future research directions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.