Recombinant Lepidium virginicum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Lepidium virginicum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered protein corresponding to the core antenna subunit CP47 in Photosystem II (PSII) of plants. It is synthesized via heterologous expression in organisms like Escherichia coli and serves as a research tool for studying PSII structure, function, and assembly. The apoprotein lacks chlorophyll but retains the structural framework for ligand binding, making it critical for reconstitution studies .

Sequence and Domain Architecture

  • Gene ID: psbB (UniProt: A4QLD2)

  • Amino Acid Length: 508 residues

  • Key Features:

    • Transmembrane Helices: Predicted to span the thylakoid membrane, forming a scaffold for chlorophyll binding.

    • Histidine Residues: Critical for coordinating chlorophyll via axial ligation. Structural models suggest five histidines directly ligate chlorophyll (within 4 Å of Mg²⁺ ions), while others may contribute indirectly .

    • Post-Translational Modifications: None explicitly reported; recombinant versions may include fusion tags (e.g., His-tag) for purification .

PropertyDetail
Molecular Weight~55 kDa (estimated from sequence length)
Expression HostE. coli
Purification TagHis-tag or undefined (varies by supplier)
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Functional Role in Photosystem II

CP47 (psbB) is a core antenna protein in PSII, stabilizing chlorophyll and facilitating energy transfer to the reaction center. Key roles include:

  1. Chlorophyll Binding: Coordinates ~14 chlorophyll molecules per subunit in native PSII .

  2. Stability and Assembly: Anchors peripheral antenna complexes (e.g., LHCII) and interacts with the D1/D2 heterodimer .

  3. Repair Mechanism: During PSII photodamage, CP47 may transiently detach from the core, enabling D1 replacement .

Production and Purity

  • Expression System: E. coli (full-length or truncated versions) .

  • Purity: >90% by SDS-PAGE .

  • Reconstitution Capability: Recombinant psbB can bind chlorophyll in vitro, though efficiency may depend on refolding conditions .

SupplierPrice (50 µg)Key Features
MyBioSource.com$1,860.00Full-length (1–508 aa), His-tag optional
Creative BiomartN/AFull-length (1–508 aa), His-tagged
Anagnostics$1,871.00Full-length, Tris/glycerol buffer

Applications in Research

  • Structural Studies: Investigating chlorophyll ligation and antenna organization .

  • Biotechnological Use: Engineering light-harvesting systems for bioenergy applications.

  • PSII Repair Models: Studying antenna detachment/reassembly during photodamage .

Chlorophyll Binding Specificity

  • Histidine Coordination: In spinach CP47, five histidines directly ligate chlorophyll, while others stabilize the protein-chlorophyll interface .

  • Reconstitution Challenges: Recombinant psbB may require optimized in vitro refolding to achieve native-like chlorophyll binding .

Comparative Insights

While Lepidium virginicum psbB shares structural homology with spinach CP47, species-specific variations in histidine placement or loop regions could influence chlorophyll affinity .

Challenges and Future Directions

  • Limited Native Studies: Most data derive from product specifications; structural characterization of Lepidium psbB remains sparse.

  • Functional Reconstitution: Achieving high-yield, functional reassembly with chlorophyll is a technical hurdle .

  • Evolutionary Adaptations: Comparative studies across species could reveal adaptive traits in psbB for enhancing PSII efficiency .

Product Specs

Form
Lyophilized powder
Note: While we prefer to ship the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag preference, please inform us, and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Lepidium virginicum (Virginia pepperweed)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47 chlorophyll apoprotein (psbB) is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from water, generating oxygen and a proton gradient that is subsequently used for ATP synthesis.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the taxonomic classification of Lepidium virginicum and how does it inform genetic studies of psbB?

Lepidium virginicum (Virginia pepperweed or least pepperwort) belongs to the mustard family (Brassicaceae), Kingdom Plantae, Order Brassicales, and Genus Lepidium. It is native to much of North America, including most of the United States, Mexico, southern Canada, and Central America . This taxonomic positioning is significant for genetic studies because it places L. virginicum in an evolutionarily distinct position from model organisms like cyanobacteria, where psbB has been extensively studied. When designing primers or expression systems for the psbB gene, researchers should consider the phylogenetic relationships within Brassicales to optimize homology-based approaches. Comparison studies with other Brassicaceae family members may provide critical insights into functional conservation of the CP47 protein across evolutionarily related species.

How does the structure of CP47 chlorophyll apoprotein contribute to Photosystem II function?

CP47 serves as a core antenna protein in Photosystem II, playing a crucial role in light harvesting and energy transfer to the reaction center. The protein contains multiple transmembrane helices that create a scaffold for chlorophyll binding. Analysis of CP47 from other species reveals that it contains five pairs of histidine residues spaced by 13 or 14 amino acids located in hydrophobic regions of the protein, which are likely involved in chlorophyll binding . The hydropathy patterns observed in CP47 from different species (such as Synechocystis and spinach) are remarkably similar, suggesting a conserved folding pattern in the thylakoid membrane . Research with L. virginicum should assess whether these structural features are maintained. Experimental approaches should include hydropathy analyses and comparative structural predictions to identify the chlorophyll-binding domains within the L. virginicum CP47 protein.

What expression systems are suitable for producing recombinant Lepidium virginicum psbB protein?

  • An appropriate promoter (T7 or similar strong, inducible promoter)

  • A His-tag or other purification tag (N-terminal tags are common for this protein class)

  • Codon optimization for the host expression system

  • Solubility enhancers such as fusion partners (MBP, SUMO, etc.)

For optimal protein folding, lower induction temperatures (16-18°C) and specialized E. coli strains designed for membrane protein expression may increase functional protein yields. Alternative eukaryotic expression systems like yeast or insect cells could be considered if proper folding proves challenging in E. coli.

How do sequence variations in the psbB gene from Lepidium virginicum compare with other species, and what functional implications might these have?

When analyzing the psbB gene from Lepidium virginicum, researchers should perform comprehensive sequence alignments with well-characterized psbB genes from other species. For reference, the DNA sequence homology between Synechocystis and spinach psbB genes is approximately 68%, while their predicted amino acid sequences show 76% homology . These comparative analyses should focus on:

  • Conservation of transmembrane domains

  • Preservation of chlorophyll-binding histidine residues

  • Variations in loop regions that might affect interaction with other Photosystem II components

It's particularly important to examine the five pairs of histidine residues that are typically spaced by 13-14 amino acids in hydrophobic regions, as these are likely involved in chlorophyll binding . Variations in these regions could suggest adaptive changes in light-harvesting capability. Functional implications can be assessed through site-directed mutagenesis experiments targeting non-conserved regions, followed by spectroscopic analyses to determine effects on chlorophyll binding and energy transfer efficiency.

What methods are most effective for assessing the functional integrity of recombinant CP47 protein, and how can researchers verify proper chlorophyll binding?

Assessing functional integrity of recombinant CP47 requires multiple complementary approaches:

Spectroscopic Analysis:

  • Absorption spectroscopy (400-700 nm range) to verify chlorophyll binding

  • Circular dichroism to confirm proper secondary structure

  • Fluorescence emission spectra to assess energy transfer capability

Biochemical Assessment:

  • Size exclusion chromatography to verify oligomeric state

  • Limited proteolysis to assess proper folding

  • Native gel electrophoresis to evaluate complex formation capability

Functional Reconstitution:

  • In vitro reconstitution with other Photosystem II components

  • Oxygen evolution assays if assembled into complete PSII complexes

  • Electron paramagnetic resonance (EPR) to evaluate electron transfer properties

Researchers should pay particular attention to the chlorophyll binding sites. Studies with Synechocystis CP47 indicate that interruption of the psbB gene results in complete loss of Photosystem II activity, highlighting the critical nature of this protein for PSII function . When working with recombinant protein, the absence of natural chlorophyll during expression requires either post-purification reconstitution with chlorophyll or co-expression systems that enable chlorophyll integration during protein synthesis.

How can researchers leverage the antiamoebic properties of Lepidium virginicum constituents in relation to CP47 studies?

While primarily studied for its photosynthetic role, the multifunctional potential of Lepidium virginicum proteins should not be overlooked. The plant has demonstrated antiprotozoal activity against Entamoeba histolytica trophozoites, with roots containing benzyl glucosinolate showing significant activity (IC₅₀ of 20.4 μg/mL) . Researchers investigating CP47 could:

  • Examine potential secondary bioactive roles of CP47 or its breakdown products

  • Investigate possible interactions between CP47 and glucosinolate biosynthesis pathways

  • Explore whether stress conditions that alter glucosinolate content also affect CP47 expression

Methodologically, this requires integrating traditional protein biochemistry with metabolomic approaches. Researchers could develop experimental designs that expose L. virginicum to various stressors, then simultaneously quantify changes in CP47 expression/activity and glucosinolate profiles. Co-immunoprecipitation studies might reveal whether CP47 interacts with enzymes involved in glucosinolate metabolism.

What purification strategies optimize yield and stability of recombinant Lepidium virginicum CP47 protein?

Purification of recombinant CP47 protein requires careful consideration of its membrane protein nature and chlorophyll-binding properties. Based on established protocols for similar proteins, researchers should implement:

Extraction Optimization:

  • Evaluate multiple detergents (DDM, LDAO, Triton X-100) for optimal solubilization

  • Consider native versus denaturing conditions based on downstream applications

  • Test detergent-to-protein ratios to maximize extraction while minimizing denaturation

Purification Strategy:

  • IMAC (Immobilized Metal Affinity Chromatography) utilizing His-tag fusion

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing and buffer exchange

Stability Considerations:

  • Maintain 5-50% glycerol in storage buffer to enhance stability

  • Store aliquoted protein at -80°C to prevent freeze-thaw damage

  • Consider lyophilization for long-term storage with appropriate cryoprotectants

For quality control, researchers should verify protein purity by SDS-PAGE (>90% purity standard) , and confirm identity through Western blotting and mass spectrometry analysis. Finally, functional assays should be conducted to ensure the purified protein retains its native chlorophyll-binding capability.

What experimental approaches can resolve the specific contribution of CP47 to the reaction center functionality in Lepidium virginicum Photosystem II?

To determine CP47's specific contribution to reaction center functionality, researchers should employ multiple complementary approaches:

Genetic Approaches:

  • CRISPR-Cas9 mediated mutations in the native psbB gene

  • Complementation studies with modified recombinant CP47 variants

  • Site-directed mutagenesis targeting putative chlorophyll-binding histidine residues

Biophysical Techniques:

  • Ultrafast transient absorption spectroscopy to measure energy transfer kinetics

  • Time-resolved fluorescence to track excitation energy movement

  • Single-molecule spectroscopy to evaluate heterogeneity in CP47 function

Structural Biology:

  • Cryo-electron microscopy of reconstituted PSII complexes

  • Cross-linking mass spectrometry to map CP47 interactions with reaction center proteins

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Studies with Synechocystis have shown that interruption of the psbB gene results in complete loss of Photosystem II activity, indicating that intact CP47 is required for functional PSII complexes, though this doesn't necessarily confirm that CP47 houses the reaction center itself . Research with L. virginicum should build on this understanding by creating partial loss-of-function mutations that specifically target energy transfer without completely disrupting protein structure.

How should environmental growth conditions be optimized when studying native expression of psbB in Lepidium virginicum?

When investigating native psbB expression in Lepidium virginicum, researchers must carefully control environmental conditions to ensure reproducible results:

Light Conditions:

  • Test multiple light intensities (50-500 μmol photons m⁻² s⁻¹)

  • Evaluate effects of different light spectra (red, blue, white)

  • Consider photoperiod variations (short day vs. long day)

Growth Medium Optimization:

  • Nutrient levels, particularly nitrogen and magnesium (essential for chlorophyll)

  • Soil vs. hydroponic systems for controlled nutrient delivery

  • pH optimization (L. virginicum prefers slightly acidic to neutral conditions)

Environmental Stressors:

  • Temperature range (optimal growth between 20-25°C)

  • Drought stress (L. virginicum naturally prefers dry soil conditions)

  • Salt stress (as L. virginicum is often found in disturbed areas)

Lepidium virginicum is native to various North American environments and is adapted to sunny locations with dry soil . It has a wetland indicator status of FACU (Facultative Upland) in multiple regions, indicating it typically occurs in non-wetland areas . Its heliophily index of 9 confirms its preference for full sun conditions . Researchers should document and report all growth parameters in detail to ensure experimental reproducibility.

How does CP47 from Lepidium virginicum compare with homologous proteins in model plant systems and what evolutionary insights can be gained?

A comprehensive comparative analysis of CP47 across species reveals important evolutionary insights:

SpeciesAmino Acid Sequence HomologyNotable Structural FeaturesEvolutionary Significance
Synechocystis (cyanobacteria)Baseline for comparisonFive pairs of histidine residues in hydrophobic regionsRepresents ancestral form of CP47
Spinach (Spinacia oleracea)76% homology to SynechocystisSimilar hydropathy pattern to SynechocystisModel system for higher plant PSII
Welwitschia mirabilis508 amino acids, full sequencedWell-characterized transmembrane topologyGymnosperm representative
Lepidium virginicumTo be determinedExpected conservation of chlorophyll-binding sitesRepresents advanced flowering plant adaptation

Researchers studying L. virginicum CP47 should conduct detailed phylogenetic analyses to place this protein in evolutionary context, particularly examining:

  • Conservation of transmembrane helices across evolutionary distances

  • Adaptation of chlorophyll-binding sites in different photosynthetic environments

  • Co-evolution of CP47 with other Photosystem II components

Evolutionary rate analysis of psbB across plant lineages can provide insights into selective pressures on photosynthetic efficiency throughout plant evolution. This comparative approach may reveal how L. virginicum has adapted its photosynthetic machinery to its ecological niche as a pioneer species often found in disturbed areas .

What emerging technologies could advance our understanding of CP47 structure-function relationships in Lepidium virginicum?

Several cutting-edge technologies hold promise for deeper insights into CP47 biology:

Cryo-EM for Membrane Protein Complexes:

  • Single-particle cryo-EM for high-resolution structure determination

  • In situ cryo-electron tomography to visualize CP47 in native thylakoid membranes

  • Time-resolved cryo-EM to capture conformational changes during energy transfer

Advanced Spectroscopy:

  • 2D electronic spectroscopy to map energy transfer pathways

  • Single-molecule FRET to examine conformational dynamics

  • Pump-probe spectroscopy to measure ultrafast energy transfer events

Integrative Omics Approaches:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Spatial transcriptomics to map psbB expression across plant tissues

  • Protein interaction networks to place CP47 in broader cellular context

Researchers should consider developing transgenic L. virginicum lines with fluorescently tagged CP47 for in vivo imaging studies. Additionally, interfacing traditional biochemical approaches with computational methods like molecular dynamics simulations could provide unprecedented insights into the dynamic behavior of this crucial photosynthetic protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.