Recombinant Lepidium virginicum Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The full-length sequence (344 residues) includes conserved domains critical for PSII function, such as the Q(B) binding pocket and chlorophyll-binding motifs. Specific residues involved in electron transfer and cofactor binding (e.g., chlorophyll, plastoquinone) are preserved in the recombinant form .

Stability and Handling

  • Storage: Stable at −20°C or −80°C; avoid repeated freeze-thaw cycles .

  • Buffer Compatibility: Tris/PBS-based buffer with 6% trehalose (pH 8.0) ensures stability during storage .

  • Reconstitution: Requires gentle handling to prevent aggregation; glycerol (50%) is recommended for long-term storage .

Functional Role

As part of the PSII core, PsbA:

  • Binds chlorophylls and other cofactors essential for light-driven water oxidation.

  • Facilitates electron transfer via the Q(B) site, where plastoquinone is reduced .

  • Participates in photoprotection mechanisms to prevent oxidative damage .

Comparative Analyses

  • Species-Specific Variations: L. virginicum PsbA differs from marine algae (e.g., Prorocentrum micans) in sequence and cofactor binding specificity .

  • Photostability: Recombinant PsbA’s stability under oxidative stress informs PSII repair pathways .

Thermal and Photostability

  • Thermal Resistance: Tetrameric WSCP from L. virginicum resists denaturation at 100°C, though PsbA’s stability is less characterized .

  • Photoprotection: Phytyl chains in Chl-binding proteins shield reactive sites from singlet oxygen (¹O₂), but PsbA’s photostability depends on precise phytyl-chain positioning .

Challenges and Considerations

  • Folding Accuracy: E. coli-expressed PsbA may lack post-translational modifications (e.g., phosphorylation), potentially altering activity .

  • Cofactor Reconstitution: Efficient binding of chlorophylls and plastoquinone requires optimized protocols .

  • Oxidative Stress: Prolonged light exposure may oxidize PsbA, necessitating antioxidant additives during assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Lepidium virginicum (Virginia pepperweed)
Target Names
psbA
Target Protein Sequence
MTAILERRETESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function

Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Lepidium virginicum Photosystem Q(B) protein and what is its role in photosynthesis?

Lepidium virginicum Photosystem Q(B) protein (also known as psbA or Photosystem II protein D1) is a critical component of the photosynthetic apparatus that functions in the electron transport chain of Photosystem II (PSII). This protein contains the binding site for QB, the secondary electron acceptor quinone that receives electrons from QA and ultimately transfers them to the plastoquinone pool. The protein plays an essential role in water oxidation and energy conversion processes during photosynthesis, specifically in the light-driven reaction that converts plastoquinone (PQ) to plastohydroquinone (PQH2). Upon receiving two electrons and two protons, PQH2 is released into the thylakoid membrane, and another PQ molecule from the membrane pool binds to the QB site . The electron transfer properties of this protein are finely tuned to optimize function while minimizing back-reactions and interactions with oxygen, which could lead to the formation of damaging reactive oxygen species.

When working with this protein, researchers should be aware that its full-length sequence consists of 344 amino acids in Lepidium virginicum, with specific domains dedicated to membrane integration, pigment binding, and electron transfer functions. The protein contains multiple transmembrane helices that anchor it within the thylakoid membrane, positioning the QB binding pocket at the optimal location for interaction with the plastoquinone pool. Understanding these structural features is essential for designing experiments that maintain proper protein folding and function.

What expression systems are recommended for recombinant production of Lepidium virginicum Photosystem Q(B) protein?

Recombinant production of Lepidium virginicum Photosystem Q(B) protein is typically performed in E. coli expression systems, which provide sufficient yield for most research applications. The commercially available recombinant form is often produced as a His-tagged fusion protein to facilitate purification . When expressing this membrane protein, it is crucial to optimize conditions that promote proper folding while preventing aggregation. Researchers have found success using specialized E. coli strains designed for membrane protein expression, along with reduced induction temperatures (16-18°C) and lower inducer concentrations to slow protein production and improve folding.

For experimental design, consider that the choice of fusion tag (such as the N-terminal His-tag) may influence protein behavior and should be validated against the specific research question being addressed. Some researchers opt for cleavable tags that can be removed after purification to minimize potential interference with protein function. The expression vector should contain appropriate regulatory elements for controlled expression, and codon optimization for E. coli may improve yields. After expression, the protein is typically found in inclusion bodies or membrane fractions, requiring specialized extraction and solubilization methods using detergents that maintain protein structure.

What are the recommended storage and handling conditions for maintaining stability of recombinant Photosystem Q(B) protein?

To maintain stability of recombinant Lepidium virginicum Photosystem Q(B) protein, lyophilized powder preparations should be stored at -20°C to -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise protein integrity . Upon reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For extended storage of reconstituted protein, the addition of glycerol to a final concentration of 5-50% (typically 50%) is recommended before aliquoting and storing at -20°C or -80°C . Working aliquots can be maintained at 4°C for up to one week, but repeated freezing and thawing should be avoided to prevent denaturation and loss of activity.

The buffer composition significantly impacts protein stability, with Tris/PBS-based buffers at pH 8.0 containing 6% trehalose being commonly used for storage . Trehalose serves as a cryoprotectant that helps maintain protein structure during freeze-thaw cycles. When designing experiments, researchers should consider that detergents may be required to maintain solubility if the protein is to be used for functional studies, as this is an intrinsic membrane protein. The choice of detergent should balance the need for solubilization with the preservation of native structure and function. Additionally, researchers should be aware that exposure to strong light might induce photodamage, particularly in samples lacking photoprotective components that would be present in native environments.

How are the redox potentials of QB in Photosystem II measured and what do they reveal about electron transfer mechanisms?

The redox potentials of QB in Photosystem II represent fundamental parameters that determine the thermodynamics of electron transfer processes. Researchers measure these values through techniques such as electron paramagnetic resonance (EPR) spectroscopy and Fourier transform infrared (FTIR) spectroscopy coupled with redox titrations. For example, in studies with Thermosynechococcus elongatus, EPR spectroscopy has been used to determine the midpoint potentials of QB, revealing values of approximately 90 mV for the QB/QB- − couple and approximately 40 mV for the QB- −/QBH2 couple . These measurements typically involve monitoring the formation of the semiquinone (QB- −) as a function of applied potential, often using potentiometric titrations where the redox state is controlled with appropriate mediators.

These redox potential measurements reveal several critical aspects of Photosystem II function. First, they demonstrate that the semiquinone (QB- −) is thermodynamically stabilized, contrary to earlier reports suggesting instability . The average midpoint potential for the complete two-electron reduction (QB/QBH2) is approximately 65 mV, which is lower than the midpoint potential of the free plastoquinone/plastohydroquinone couple (approximately 117 mV) . This difference of about 50 meV represents the driving force for QBH2 release into the plastoquinone pool. The data also indicate that plastoquinone (PQ) binds approximately 50 times more tightly than plastohydroquinone (PQH2), which optimizes PSII function even when the plastoquinone pool is largely reduced . Furthermore, the difference between the redox potentials of QB and QA (approximately 234 meV) determines the driving force for electron transfer from QA- − to QB . These energetic parameters explain how PSII maintains forward electron flow while minimizing back-reactions and side reactions with oxygen.

What is the relationship between Lepidium virginicum Photosystem Q(B) protein and the water-soluble chlorophyll-binding protein (WSCP)?

How do spectroscopic techniques contribute to understanding energy transfer in Lepidium virginicum chlorophyll-binding proteins?

Spectroscopic techniques have been instrumental in elucidating the energy transfer mechanisms in Lepidium virginicum chlorophyll-binding proteins, particularly in water-soluble chlorophyll-binding proteins (WSCPs) that share structural relationships with components of the photosynthetic apparatus. Absorption, emission, and hole-burned (HB) spectra, along with the shape of the zero-phonon hole (ZPH) action spectrum, have provided evidence for uncorrelated excitation energy transfer between chlorophyll dimers in recombinant LvWSCP . These techniques allow researchers to probe the electronic structure and dynamics of pigment-protein complexes with high precision.

Hole-burning spectroscopy has been particularly valuable in characterizing the photophysical processes in LvWSCP. This technique has revealed that electron exchange can occur between the lowest energy chlorophylls and the protein, with electrons being trapped at low temperatures by nearby aromatic amino acids . This phenomenon explains the observed shape of nonresonant hole-burned spectra, specifically the absence of an antihole, demonstrating that the hole-burning process in LvWSCP is largely photochemical in nature . A smaller contribution from nonphotochemical hole burning is also observed in resonant holes. Importantly, these spectroscopic analyses have challenged previous interpretations that required slow protein relaxation within the lowest excited state to explain the large shift between the maxima of the ZPH action and emission spectra . The current evidence supports a model where energy transfer between uncorrelated chlorophyll dimers accounts for the observed spectral properties.

When designing spectroscopic experiments for these proteins, researchers should consider temperature-dependent measurements to distinguish between different energy transfer and relaxation mechanisms. Low-temperature spectroscopy (typically at liquid helium temperatures) provides higher resolution and can reveal subtle features in the energy landscape that are obscured at room temperature due to thermal broadening. Time-resolved measurements are also valuable for directly observing energy transfer dynamics and distinguishing between competing mechanisms.

What reconstitution protocols ensure optimal activity of recombinant Lepidium virginicum Photosystem Q(B) protein?

Successful reconstitution of recombinant Lepidium virginicum Photosystem Q(B) protein requires careful attention to several critical parameters to ensure optimal activity. The commercially available lyophilized protein should first be briefly centrifuged to bring contents to the bottom of the vial before opening . Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended, followed by the addition of glycerol (5-50% final concentration) if the protein will be stored for extended periods . When designing reconstitution protocols for specific experimental applications, researchers should consider several important factors that can influence protein activity.

The choice of lipids for reconstitution into liposomes or nanodiscs is crucial for membrane proteins like Photosystem Q(B) protein. A mixture of phosphatidylcholine, phosphatidylglycerol, and other thylakoid membrane-mimicking lipids often provides an environment that supports proper protein folding and function. The lipid-to-protein ratio should be optimized to prevent protein aggregation while ensuring sufficient coverage of hydrophobic surfaces. Temperature control during reconstitution is essential, with room temperature or slightly below (16-20°C) typically yielding better results than higher temperatures that might promote aggregation. Detergent removal techniques, such as dialysis, absorption to Bio-beads, or gel filtration, should be performed gradually to allow proper refolding and insertion into lipid bilayers.

For functional studies, the reconstitution buffer should contain appropriate cofactors, particularly plastoquinone or synthetic quinone analogs that will occupy the QB binding site. The redox state of these quinones may need to be controlled using reducing agents like sodium dithionite or oxidizing agents like ferricyanide, depending on the experimental goals. When assessing reconstitution success, researchers should employ multiple complementary techniques including absorption spectroscopy, circular dichroism, and activity assays that monitor electron transfer capabilities.

What analytical techniques are most effective for studying QB binding and electron transfer in recombinant PSII proteins?

Multiple analytical techniques provide complementary information about QB binding and electron transfer in recombinant PSII proteins. Electron paramagnetic resonance (EPR) spectroscopy has proven highly effective for detecting and characterizing the semiquinone radical (QB- −) formed during electron transfer . This technique allows direct observation of the radical species and can be combined with redox titrations to determine midpoint potentials of the QB/QB- − and QB- −/QBH2 couples. Time-resolved EPR can also reveal kinetics of radical formation and decay, providing insights into electron transfer rates.

Fourier transform infrared (FTIR) difference spectroscopy offers complementary structural information by detecting subtle changes in protein and cofactor vibrations upon quinone reduction. This technique can identify specific amino acid residues involved in quinone binding and protonation events during the reduction cycle. X-ray crystallography, while challenging with recombinant systems, provides the most detailed structural information about the QB binding pocket when successful. Cryo-electron microscopy (cryo-EM) has emerged as an alternative structural technique that may require less protein and can sometimes capture different functional states.

Functional analysis of electron transfer typically employs spectrophotometric techniques that monitor absorbance changes associated with redox events. Oxygen evolution measurements using Clark-type electrodes or membrane-inlet mass spectrometry can assess the coupling between QB reduction and water oxidation. Thermoluminescence measurements provide information about charge recombination events and have been used to estimate the energy gap between QA and QB redox couples . Flash-induced absorption spectroscopy with single or multiple turnover flashes can resolve the kinetics of electron transfer from QA to QB and subsequent protonation steps. When interpreting data from these techniques, researchers should be aware that the lipid environment, detergent choice, and presence of additional protein subunits can significantly influence the measured parameters, necessitating careful control experiments.

How can researchers address data inconsistencies in redox potential measurements of Photosystem II components?

Inconsistencies in redox potential measurements of Photosystem II components, particularly regarding the QB redox couples, have been reported in scientific literature and require careful methodological considerations to resolve. One significant discrepancy involves the thermodynamic stability of the semiquinone (QB- −), with some reports suggesting instability while others demonstrate stabilization . These inconsistencies may arise from differences in experimental approaches, sample preparation, or data interpretation. Researchers can address these discrepancies through several methodological strategies to ensure reliable measurements.

First, employing multiple independent techniques to measure the same parameter provides cross-validation. For example, combining EPR spectroscopy with FTIR or thermoluminescence measurements to determine redox potentials can identify technique-specific artifacts. Sample homogeneity is critical, as heterogeneous preparations may contain subpopulations with different properties. Purification protocols should be optimized and standardized to ensure consistent starting material, and the integrity of protein complexes should be verified using size exclusion chromatography, native gel electrophoresis, or analytical ultracentrifugation before redox measurements.

The choice of redox mediators is particularly important when conducting potentiometric titrations, as mediators must efficiently equilibrate with the protein without interfering with its function. A cocktail of mediators covering the potential range of interest is typically used, but their potential effects on protein stability should be assessed. Temperature, pH, and ionic strength must be carefully controlled, as these factors can significantly influence measured redox potentials. When comparing results across studies, researchers should normalize values to account for differences in reference electrodes or measurement conditions. Statistical analysis of replicate measurements is essential for establishing confidence intervals and identifying outliers.

Additionally, researchers should consider that apparent discrepancies might reflect genuine biological variability or alternative functional states rather than experimental errors. For example, the different redox potentials reported for QB in various species or under different biochemical conditions might represent evolutionary adaptations or regulatory mechanisms. By combining rigorous experimental controls with critical evaluation of existing literature, researchers can develop a more consistent understanding of the redox properties of Photosystem II components.

How does the Lepidium virginicum Photosystem Q(B) protein compare to homologous proteins in other species?

The redox properties of QB show interesting variations across species. Studies in Thermosynechococcus elongatus have established midpoint potentials for the QB/QB- − and QB- −/QBH2 couples at approximately 90 mV and 40 mV, respectively . These values create an energy gap between QA and QB that drives forward electron transfer while minimizing back-reactions. Comparisons with the homologous purple bacterial reaction center have revealed similar energetic principles despite structural differences, suggesting convergent evolution of optimal electron transfer parameters . The energetics of QB appear tuned to balance several competing requirements: providing sufficient driving force for electron transfer, minimizing back-reactions, preventing side reactions with oxygen, and optimizing the binding equilibrium between substrate (PQ) and product (PQH2).

From an evolutionary perspective, the comparison of Photosystem Q(B) proteins across species provides insights into the adaptation of photosynthetic machinery to different ecological niches. Species from high-light environments often show modifications that enhance photoprotection, while those from shade environments may prioritize light-harvesting efficiency. The exchange of the D1 protein (containing the QB binding site) during the PSII repair cycle is a critical process in all photosynthetic organisms, but the regulation and rate of this process vary across species, reflecting different strategies for coping with photodamage. Future comparative studies using recombinant proteins from diverse species could further elucidate the molecular basis of these adaptations and potentially inform efforts to engineer photosynthetic organisms with enhanced stress tolerance or productivity.

What are the emerging applications for recombinant Photosystem II proteins in biotechnology and renewable energy research?

Recombinant Photosystem II proteins, including the Lepidium virginicum Photosystem Q(B) protein, are finding increasingly diverse applications in biotechnology and renewable energy research. One promising direction involves the development of bio-inspired solar energy conversion systems that mimic the remarkable efficiency of natural photosynthesis. By incorporating recombinant PSII components into artificial membranes or electrode surfaces, researchers aim to create bio-hybrid devices capable of light-driven water splitting to produce hydrogen as a clean fuel. The detailed understanding of the redox properties and electron transfer mechanisms in proteins like the Photosystem Q(B) protein is essential for optimizing these systems.

Biosensor development represents another emerging application area. The electron transfer properties of PSII proteins make them suitable transducers for detecting environmental pollutants that inhibit photosynthetic activity. Recombinant proteins can be engineered with modified binding sites to enhance sensitivity to specific analytes or to improve stability in sensor platforms. The water-soluble variants of photosynthetic proteins, similar to the WSCPs discussed earlier, offer particular advantages for biosensor applications due to their enhanced stability outside the thylakoid membrane environment and their potential for immobilization on various surfaces.

From a fundamental science perspective, recombinant PSII proteins provide valuable model systems for studying electron transfer mechanisms, protein-cofactor interactions, and the molecular basis of photodamage and repair processes. The ability to introduce site-specific mutations and incorporate non-natural amino acids or modified cofactors opens new possibilities for understanding and enhancing the function of these complex molecular machines. As synthetic biology capabilities advance, there is growing interest in designing minimal photosynthetic units with enhanced properties for specific applications, such as increased tolerance to extreme conditions or the ability to use alternative electron donors or acceptors.

The development of standardized expression and reconstitution protocols for recombinant photosynthetic proteins will be crucial for accelerating progress in these areas. Future research will likely focus on improving protein yield and stability, developing methods for incorporating the full complement of cofactors, and establishing reliable functional assays suitable for high-throughput screening of variant proteins. The integration of recombinant photosynthetic components with nanomaterials and novel electrode designs represents a particularly promising direction for renewable energy applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.